Recombinant Human GMP Reductase 1, GMPR (C-6His)

Contact us
Catalog number: C867
Price: 496 €
Supplier: novo
Product name: Recombinant Human GMP Reductase 1, GMPR (C-6His)
Quantity: 50 µg
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human GMP Reductase 1 is produced by our Mammalian expression system and the target gene encoding Met1-Ser345 is expressed with a 6His tag at the C-terminus
Molecular Weight: 38, 5 kD
UniProt number: P36959
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: pH8, 15M sodium chloride and 1 mM DTT, 2 um filtered solution of 20 mM Tris-HCl, 40% glycerol, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFSVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: GMPR (C-6His), GMP Reductase 1
Short name: GMPR (C-6His), Recombinant GMP Reductase 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: GMPR (C-6His), sapiens GMP Reductase 1, recombinant H
Alternative technique: rec
Identity: 4376
Gene: GMPR | More about : GMPR
Long gene name: guanosine monophosphate reductase
Synonyms name: GMP reductase 1
Locus: 6p22, 3
Discovery year: 1990-11-09
Entrez gene record: 2766
Pubmed identfication: 2194676
Havana BLAST/BLAT: OTTHUMG00000014302

Related Products :

C867 Recombinant Human GMP Reductase 1, GMPR (C-6His) 500 µg 1613 € novo human
GENTAUR-58b9ca5451e29 Human GMP reductase 1 (GMPR) 100ug 1989 € MBS Recombinant Proteins human
GENTAUR-58b9ca5482fb7 Human GMP reductase 1 (GMPR) 1000ug 1989 € MBS Recombinant Proteins human
GENTAUR-58b9ca5525441 Human GMP reductase 1 (GMPR) 100ug 2498 € MBS Recombinant Proteins human
GENTAUR-58b9ca56b42a8 Human GMP reductase 1 (GMPR) 1000ug 2498 € MBS Recombinant Proteins human
RP-0752H Recombinant Human GMPR / GMPR1 Protein (His Tag) 20μg 572 € adv human
GWB-P0628D GMPR, 1-345aa , Human, His tag, E.coli bulk Ask price € genways bulk human
LV170956 GMPR Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV170957 GMPR Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV170958 GMPR Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV170959 GMPR Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV170961 GMPR Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV170960 GMPR Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bdf268c743c Anti- GMPR Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf26933214 Anti- GMPR Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be435b25352 Anti- GMPR Antibody 100ug 370 € MBS Polyclonals human
GENTAUR-58be46091a9f7 Anti- GMPR Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be53817cbaa Anti- GMPR Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58be5381df350 Anti- GMPR Antibody 0.2 mg 663 € MBS Polyclonals human
abx902206 Anti-GMPR siRNA inquire 50 € abbex human
abx918128 Anti-GMPR siRNA 15 nmol 528 € abbex human
abx918129 Anti-GMPR siRNA inquire 50 € abbex human
GWB-MW616D GMPR antibody 1 vial 521 € genways human
GWB-C49560 GMPR Over-expression Lysate reagent 1 vial 463 € genways human
MBS624060 GMPS, CT (GMP Synthase [Glutamine-hydrolyzing], Glutamine Amidotransferase, GMP Synthetase) Antibody 200ul 603 € MBS Polyclonals_1 human
C985 Recombinant Human Aldo-Keto Reductase 1C3, AKR1C3 (C-6His) 500 µg 1613 € novo human
CE36 Recombinant Human Aldo-Keto Reductase 1C4, AKR1C4 (N-6His) 1 mg 2283 € novo human
CK04 Recombinant Human Biliverdin Reductase A, BVR A (C-6His) 50 µg 369 € novo human
C852 Recombinant Human Dihydropteridine Reductase, QDPR (C-6His) 50 µg 369 € novo human
C277 Recombinant Human L-Xylulose Reductase, DCXR (N-6His) 50 µg 496 € novo human