Recombinant Human Dihydropteridine Reductase, QDPR (C-6His)

Contact us
Catalog number: C852
Price: 1613 €
Supplier: novo
Product name: Recombinant Human Dihydropteridine Reductase, QDPR (C-6His)
Quantity: 500 µg
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Dihydropteridine Reductase is produced by our Mammalian expression system and the target gene encoding Ala2-Phe244 is expressed with a 6His tag at the C-terminus
Molecular Weight: 26, 8 kD
UniProt number: P09417
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYFVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: QDPR (C-6His), Dihydropteridine Reductase
Short name: QDPR (C-6His), Recombinant Dihydropteridine Reductase
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: QDPR (C-6His), sapiens Dihydropteridine Reductase, recombinant H
Alternative technique: rec
Identity: 9752
Gene: QDPR | More about : QDPR
Long gene name: quinoid dihydropteridine reductase
Synonyms: DHPR PKU2 SDR33C1
Synonyms name: 6, member 1 , 7-dihydropteridine reductase short chain dehydrogenase/reductase family 33C
Locus: 4p15, 32
Discovery year: 2001-06-22
GenBank acession: AB053170
Entrez gene record: 5860
Pubmed identfication: 19027726
RefSeq identity: NM_000320
Classification: Short chain dehydrogenase/reductase superfamily
Havana BLAST/BLAT: OTTHUMG00000128537
Locus Specific Databases: BIOMDBdb: Database of Mutations Causing BH4 Deficiencies and other PND

Related Products :

MBS623850 QDPR, CT (Quinoid Dihydropteridine Reductase, HDHPR, Dihydropteridine Reductase, DHPR) 200ul 603 € MBS Polyclonals_1 human
C852 Recombinant Human Dihydropteridine Reductase, QDPR (C-6His) 50 µg 369 € novo human
DL-QDPR-Hu Human Quinoid Dihydropteridine Reductase QDPR ELISA Kit 96T 904 € DL elisas human
AE24881PI-48 ELISA test for Pig Dihydropteridine reductase (QDPR) 1x plate of 48 wells 402 € abebio pig
AE24881PI-96 Pig Dihydropteridine reductase (QDPR) ELISA Kit 1x plate of 96 wells 671 € abebio pig
EKU06999 Quinoid Dihydropteridine Reductase (QDPR) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
abx166524 Anti-Quinoid Dihydropteridine Reductase Protein (Recombinant) 10 μg 369 € abbex human
abx250962 Anti-Human Dihydropteridine reductase ELISA Kit inquire 50 € abbex human
abx128258 Anti-Quinoid Dihydropteridine Reductase Antibody 10 μg 282 € abbex human
GWB-P0866H QDPR, 1-244aa, Recombinant Protein bulk Ask price € genways bulk human
abx152907 Anti-Human QDPR ELISA Kit inquire 50 € abbex human
abx571250 Anti-Human QDPR ELISA Kit inquire 50 € abbex human
LV279367 QDPR Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
AR39112PU-L anti-QDPR (1-244, His-tag) Antibody 0,5 mg 1500 € acr human
AR39112PU-N anti-QDPR (1-244, His-tag) Antibody 0,1 mg 587 € acr human
GENTAUR-58be0ea32f00a Anti- QDPR Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0ea365881 Anti- QDPR Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be44e9823fb Anti- QDPR Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be4a30b1b83 Anti- QDPR Antibody 100ug 370 € MBS Polyclonals human
GENTAUR-58be53449babe Anti- QDPR Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be534514285 Anti- QDPR Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58be534576275 Anti- QDPR Antibody 100ug 387 € MBS Polyclonals human
abx127024 Anti-QDPR Antibody inquire 50 € abbex human
abx141790 Anti-QDPR Antibody 50 μl 311 € abbex human
abx904400 Anti-QDPR siRNA 30 nmol 717 € abbex human
abx930540 Anti-QDPR siRNA 30 nmol 717 € abbex human
abx930541 Anti-QDPR siRNA 30 nmol 717 € abbex human
MBS270313 QDPR antibody 100ul 426 € MBS Polyclonals_1 human
YSRTMCA3398Z QDPR, Mouse Monoclonal antibody-; Clone: M1 0.1 mg Ask price € accurate-monoclonals mouse
C985 Recombinant Human Aldo-Keto Reductase 1C3, AKR1C3 (C-6His) 500 µg 1613 € novo human