Recombinant Human 15-PGDH, HPGD (C-6His)

Contact us
Catalog number: C848
Price: 322 €
Supplier: ABM lentivectors
Product name: Recombinant Human 15-PGDH, HPGD (C-6His)
Quantity: 1.0 µg DNA
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human HPGD is produced by our Mammalian expression system and the target gene encoding Met1-Gln266 is expressed with a 6His tag at the C-terminus
Molecular Weight: 30 kD
UniProt number: P15428
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM HEPES, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: HPGD (C-6His), 15-PGDH
Short name: HPGD (C-6His), Recombinant 15-PGDH
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: hydroxyprostaglandin dehydrogenase 15-(Nicotinamide adenine dinucleotide) (C-6His), sapiens 15-PGDH, recombinant H
Alternative technique: rec
Alternative to gene target: 15-PGDH and PGDH and PGDH1 and PHOAR1 and SDR36C1, BT, HPGD and IDBG-44946 and ENSG00000164120 and 3248, Hpgd and IDBG-155950 and ENSMUSG00000031613 and 15446, NAD+ binding, Plasma membranes, this GO :0003824 and catalytic activity and molecular function this GO :0004957 and prostaglandin E receptor activity and molecular function this GO :0005829 and cytosol and cellular component this GO :0006693 and prostaglandin metabolic process and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007565 and female pregnancy and biological process this GO :0007567 and parturition and biological process this GO :0008152 and metabolic process and biological process this GO :0016323 and basolateral plasma membrane and cellular component this GO :0016404 and 15-hydroxyprostaglandin dehydrogenase (NAD+) activity and molecular function this GO :0016491 and oxidoreductase activity and molecular function this GO :0019369 and arachidonic acid metabolic process and biological process this GO :0019371 and cyclooxygenase pathway and biological process this GO :0019372 and lipoxygenase pathway and biological process this GO :0030728 and ovulation and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0044281 and small molecule metabolic process and biological process this GO :0045786 and negative regulation of cell cycle and biological process this GO :0050662 and coenzyme binding and molecular function this GO :0051287 and NAD binding and molecular function this GO :0055114 and oxidation-reduction process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070403 and NAD+ binding and molecular function this GO :0070493 and thrombin receptor signaling pathway and biological process this GO :0097070 and ductus arteriosus closure and biological process this GO :2001300 and lipoxin metabolic process and biological process, this GO :0003824 : catalytic activity, this GO :0003824 : catalytic activity and also this GO :0004957 : prostaglandin E receptor activity and also this GO :0016404 : 15-hydroxyprostaglandin dehydrogenase (NAD+) activity and also this GO :0016491 : oxidoreductase activity and also this GO :0042803 : protein homodimerization activity and also this GO :0050662 : coenzyme binding and also this GO :0051287 : NAD binding and also this GO :0070403 : NAD+ binding, this GO :0004957 : prostaglandin E receptor activity, this GO :0016404 : 15-hydroxyprostaglandin dehydrogenase (NAD+) activity, this GO :0016491 : oxidoreductase activity, this GO :0042803 : protein homodimerization activity, this GO :0050662 : coenzyme binding, this GO :0051287 : NAD binding, this GO :0070403 : NAD+ binding, 43717 and IDBG-629346 and ENSBTAG00000025942 and 512259, hydroxyprostaglandin dehydrogenase 15-(NAD)
Identity: 5154
Gene: HPGD | More about : HPGD
Long gene name: hydroxyprostaglandin dehydrogenase 15-(NAD)
Synonyms: SDR36C1
Synonyms name: member 1 , short chain dehydrogenase/reductase family 36C
Locus: 4q34, 1
Discovery year: 1991-07-16
Entrez gene record: 3248
Pubmed identfication: 19027726
Classification: Short chain dehydrogenase/reductase superfamily
Havana BLAST/BLAT: OTTHUMG00000160772

Related Products :

MBS620994 Prostaglandin Dehydrogenase 1 (PGDH1, 15-Hydroxyprostaglandin Dehydrogenase [NAD+], Hydroxyprostaglandin Dehydrogenase 15-(NAD), HPGD, 15-PGDH, PGDH) 100ug 735 € MBS Polyclonals_1 human
MBS622606 Prostaglandin Dehydrogenase 1 (PGDH1, 15-Hydroxyprostaglandin Dehydrogenase [NAD+], Hydroxyprostaglandin Dehydrogenase 15-(NAD), HPGD, 15-PGDH, PGDH) Antibody 100ul 630 € MBS Polyclonals_1 human
MBS622340 Prostaglandin Dehydrogenase 1 (PGDH1, 15-Hydroxyprostaglandin Dehydrogenase [NAD+], Hydroxyprostaglandin Dehydrogenase 15-(NAD), HPGD, 15-PGDH, PGDH) (Biotin) 100ul 796 € MBS Polyclonals_1 human
MBS621311 Prostaglandin Dehydrogenase 1 (PGDH1, 15-Hydroxyprostaglandin Dehydrogenase [NAD+], Hydroxyprostaglandin Dehydrogenase 15-(NAD), HPGD, 15-PGDH, PGDH) (HRP) 100ul 796 € MBS Polyclonals_1 human
C848 Recombinant Human 15-PGDH, HPGD (C-6His) 500 µg 1613 € novo human
RP-0800H Recombinant Human HPGD / 15-PGDH Protein (His Tag) 10μg 624 € adv human
RP-1327M Recombinant Mouse HPGD / 15-PGDH Protein (His Tag) 20μg 572 € adv mouse
MBS242304 Goat Polyclonal to Human 15-PGDH / HPGD Antibody 50ug 597 € MBS Polyclonals_1 human
MBS247393 PAb (IgG) to Human 15-PGDH / HPGD 100ul 597 € MBS Polyclonals_1 human
MBS248692 PAb (IgG) to Human 15-PGDH / HPGD Antibody 0.05 ml 597 € MBS Polyclonals_1 human
MBS621677 Prostaglandin Dehydrogenase 1 (HPGD, PGDH1, 15-PGDH, hydroxyprostaglandin dehydrogenase 15-(NAD), Prostaglandin dehydrogenase 1) Antibody 100ug 591 € MBS Polyclonals_1 human
MBS621755 Prostaglandin Dehydrogenase 1 (HPGD, PGDH1, 15-PGDH, hydroxyprostaglandin dehydrogenase 15-(NAD), Prostaglandin dehydrogenase 1) Antibody 100ug 774 € MBS Polyclonals_1 human
RP-1214H Recombinant Human PGDH / PHGDH Protein (His Tag) 20μg 572 € adv human
GENTAUR-58bde68b4e53a Mouse Monoclonal [clone 4A3-1D6] (IgG1,k) to Human PHGDH / PGDH Antibody 50ug 663 € MBS mono human
MBS248975 PAb (IgG) to Human PHGDH / PGDH 0.05 ml 597 € MBS Polyclonals_1 human
R33680-100UG 15-PGDH Antibody 0.1mg 406 € NJS poly human
AR09403PU-L anti-PGD / PGDH (1-483, His-tag) Antibody 0,5 mg 1022 € acr human
AR09403PU-N anti-PGD / PGDH (1-483, His-tag) Antibody 0,1 mg 413 € acr human
AR51993PU-N anti-PGD / PGDH (1-483, His-tag) Antibody 0,1 mg 587 € acr human
AR51993PU-S anti-PGD / PGDH (1-483, His-tag) Antibody 20 Вµg 311 € acr human
AP21369PU-N anti-PGD / PGDH Antibody 1 mg 688 € acr human
MBS624374 PHGDH, NT (D-3-phosphoglycerate Dehydrogenase, 3-PGDH, PGDH3) 200ul 603 € MBS Polyclonals_1 human
GWB-P1319F HPGD, 1-266aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-BSP208 HPGD Human Protein bulk Ask price € genways bulk human
LV183724 HPGD Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV183725 HPGD Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV183726 HPGD Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV183727 HPGD Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV183729 HPGD Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV183728 HPGD Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human