Recombinant Human Cyclin-Dependent Kinase 7, CDK7 (N-6His)

Contact us
Catalog number: C842
Price: 369 €
Supplier: novo
Product name: Recombinant Human Cyclin-Dependent Kinase 7, CDK7 (N-6His)
Quantity: 50 µg
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Cyclin-Dependent Kinase 7 is produced by our E, coli expression system and the target gene encoding Met1-Phe346 is expressed with a 6His tag at the N-terminus
Molecular Weight: 2 kD, 41
UniProt number: P50613
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 100 mM sodium chloride, 2 um filtered solution of 50 mM PB, 20%Glycerol pH7, 5 mM DTT, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CDK7 (N-6His), Cyclin-Dependent Kinase 7
Short name: CDK7 (N-6His), Recombinant Cyclin-Dependent Kinase 7
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CDK7 (N-6His), sapiens Cyclin-Dependent phosphorylation catalyst 7, recombinant H
Alternative technique: rec
Identity: 1778
Gene: CDK7 | More about : CDK7
Long gene name: cyclin dependent kinase 7
Synonyms gene name: Xenopus laevis, cdk-activating kinase) , cyclin-dependent kinase 7 (homolog of Xenopus MO15 cdk-activating kinase) cyclin-dependent kinase 7 (MO15 homolog
Synonyms: CAK1 CDKN7 MO15 STK1 CAK
Locus: 5q13, 2
Discovery year: 1994-12-16
Entrez gene record: 1022
Pubmed identfication: 8069918
RefSeq identity: NM_001799
Classification: Cyclin dependent kinases
Havana BLAST/BLAT: OTTHUMG00000099358

Related Products :

C842 Recombinant Human Cyclin-Dependent Kinase 7, CDK7 (N-6His) 50 µg 496 € novo human
YSGKAMCC107E Cyclin Dependent Kinase 2 (cdk2), Cyclin Dependent Kinase 5 (cdk5), NO X w/Cyclin Dependent Kinase (cdk)1, ~33kD, Clone: 8A12, Mouse Monoclonal antibody-Human, Mouse; WB 0.1mg 1271 € accurate-monoclonals mouse
BMDV10060 Cyclin Dependent Kinase 7 (cdk7), p40MO15, CAK, 40kD, C-terminal, Clone: MO-1.1, Mouse Monoclonal antibody-Human, Rat, NO X w/Mouse; frozen, IH/flow/Kinase/WB/IP (native & denatured) 500ul 808 € accurate-monoclonals mouse
abx574077 Anti-Human Cyclin Dependent Kinase 7 (CDK7) ELISA Kit inquire 50 € abbex human
BYA9013-1 Cyclin Dependent Kinase 7 (cdk7), CAK, 40kD, Clone: MO-1.1, Mouse Monoclonal antibody-Human; IB/IH/IP/ICC 0.2 ml 769 € accurate-monoclonals human
OBT4484 Cyclin Dependent Kinase 7 (cdk7), p40MO15, C-terminal, 40kD, Clone: MO-1, Mouse Monoclonal antibody-Human; frozen, IH/WB/IP 0.1 mg Ask price € accurate-monoclonals human
GWB-2F6E1A Cyclin-Dependent Kinase 7 (CDK7) Rabbit antibody to or anti-Human Polyclonal (pSer167 pThr170) antibody 1 x 1 vial 602 € genways human
DL-CDK7-Hu Human Cyclin Dependent Kinase 7 CDK7 ELISA Kit 96T 869 € DL elisas human
GENTAUR-58bdc5d4cc7fb Anti- Cyclin Dependent Kinase 7 (CDK7) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdc5d534dce Anti- Cyclin Dependent Kinase 7 (CDK7) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdc982b8145 Anti- Cyclin Dependent Kinase 7 (CDK7) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc983054c9 Anti- Cyclin Dependent Kinase 7 (CDK7) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdd18571f9b Anti- Cyclin Dependent Kinase 7 (CDK7) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd288c8ee4 Anti- Cyclin Dependent Kinase 7 (CDK7) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdd72d64fff Anti- Cyclin Dependent Kinase 7 (CDK7) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddd73614e0 Anti- Cyclin Dependent Kinase 7 (CDK7) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bb82c1dd33f Carassius auratus Cyclin-dependent kinase 7 (cdk7) 100ug 1984 € MBS Recombinant Proteins human
GENTAUR-58bb82c2731be Carassius auratus Cyclin-dependent kinase 7 (cdk7) 1000ug 1984 € MBS Recombinant Proteins human
GENTAUR-58bb82c2bba30 Carassius auratus Cyclin-dependent kinase 7 (cdk7) 100ug 2498 € MBS Recombinant Proteins human
GENTAUR-58bb82c3134c7 Carassius auratus Cyclin-dependent kinase 7 (cdk7) 1000ug 2498 € MBS Recombinant Proteins human
E-EL-Ch0259 Chicken CDK7 (Cyclin Dependent Kinase 7) ELISA Kit 96T 568 € elabsciences chicken
GENTAUR-58bcdb0416e47 Xenopus laevis Cyclin-dependent kinase 7 (cdk7) 100ug 2006 € MBS Recombinant Proteins xenopus
GENTAUR-58bcdb0467646 Xenopus laevis Cyclin-dependent kinase 7 (cdk7) 1000ug 2006 € MBS Recombinant Proteins xenopus
GENTAUR-58bcdb04af061 Xenopus laevis Cyclin-dependent kinase 7 (cdk7) 100ug 2520 € MBS Recombinant Proteins xenopus
GENTAUR-58bcdb04e6df8 Xenopus laevis Cyclin-dependent kinase 7 (cdk7) 1000ug 2520 € MBS Recombinant Proteins xenopus
MBS616679 CDKN1B (CDKN1B, cyclin-dependent kinase inhibitor 1B (p27, Kip1), KIP1, CDKN4, P27KIP1, cyclin-dependent kinase inhibitor 1B, p27(KIP1), KIP1, p27) 100ug 735 € MBS Polyclonals_1 human
MBS624101 p27Kip1, phosphorylated (Thr198) (Cyclin-dependent Kinase Inhibitor 1B, Cyclin-dependent Kinase Inhibitor p27, CDKN1B, KIP1) 200ul 603 € MBS Polyclonals_1 human
C977 Recombinant Human Cyclin-Dependent Kinase 2-Associated Protein 1, CDK2AP1 (C-6His) 10 µg 202 € novo human
C211 Recombinant Human Cyclin-Dependent Kinase 2, CDK2 (N-6His) 500 µg 1613 € novo human
CF12 Recombinant Human Cyclin-Dependent Kinase 4, CDK4 (N-6His) 50 µg 369 € novo human