Recombinant Human Bone Marrow Proteoglycan, BMPG (C-6His)

Contact us
Catalog number: C818
Price: 311 €
Supplier: acr
Product name: Recombinant Human Bone Marrow Proteoglycan, BMPG (C-6His)
Quantity: 0,1 mg
Other quantities: 1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Bone Marrow Proteoglycan is produced by our Mammalian expression system and the target gene encoding Leu17-Tyr222 is expressed with a 6His tag at the C-terminus
Molecular Weight: 24, 6 kD
UniProt number: P13727
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGYWRRAHCLRRLPFICSYVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: BMPG (C-6His), Bone Marrow Proteoglycan
Short name: BMPG (C-6His), Recombinant Bone Marrow Proteoglycan
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: BMPG (C-6His), sapiens Bone Marrow Proteoglycan, recombinant H
Alternative technique: rec
Identity: 9362
Gene: PRG2 | More about : PRG2
Long gene name: pro eosinophil major basic protein , proteoglycan 2
Synonyms gene name: bone marrow (natural killer cell activator, eosinophil granule major basic protein) , proteoglycan 2
Synonyms: MBP BMPG proMBP
Synonyms name: eosinophil major basic protein
Locus: 11q12, 1
Discovery year: 1993-09-29
GenBank acession: BC005929
Entrez gene record: 5553
Pubmed identfication: 1565101
RefSeq identity: NM_002728
Classification: C-type lectin domain containing
Havana BLAST/BLAT: OTTHUMG00000167027

Related Products :

C818 Recombinant Human Bone Marrow Proteoglycan, BMPG (C-6His) 10 µg 202 € novo human
T18-041-N1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Normal bone Marrow Anemic) Antibody 0,1 mg 311 € acr human
T18-024-N1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Normal bone Marrow) Antibody 0,1 mg 268 € acr human
T18-025-N1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Normal bone Marrow) Antibody 0,1 mg 268 € acr human
T18-027-N1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Normal bone Marrow) Antibody 0,1 mg 268 € acr human
T18-028-N1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Normal bone Marrow) Antibody 0,1 mg 268 € acr human
T18-029-N1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Normal bone Marrow) Antibody 0,1 mg 268 € acr human
T18-030-N1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Normal bone Marrow) Antibody 0,1 mg 268 € acr human
T18-031-N1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Normal bone Marrow) Antibody 0,1 mg 268 € acr human
T18-032-N1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Normal bone Marrow) Antibody 0,1 mg 268 € acr human
T18-033-N1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Normal bone Marrow) Antibody 0,1 mg 268 € acr human
T18-034-N1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Normal bone Marrow) Antibody 0,1 mg 268 € acr human
T18-035-N1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Normal bone Marrow) Antibody 0,1 mg 268 € acr human
T18-036-N1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Normal bone Marrow) Antibody 0,1 mg 268 € acr human
T18-037-N1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Normal bone Marrow) Antibody 0,1 mg 311 € acr human
T18-038-N1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Normal bone Marrow) Antibody 0,1 mg 311 € acr human
T18-039-N1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Normal bone Marrow) Antibody 0,1 mg 311 € acr human
T18-040-N1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Normal bone Marrow) Antibody 0,1 mg 311 € acr human
MBS620547 CD157 (BST1, bone marrow stromal cell antigen 1, ADP-ribosyl cyclase 2 precursor, Bone marrow stromal antigen 1, BST-1, cADPr hydrolase 2, CD157 antigen, Cyclic ADP-ribose hydrolase 2) (Biotin) 50ug 818 € MBS Polyclonals_1 human
GENTAUR-58bd868804158 Mouse Bone marrow proteoglycan (Prg2) 100ug 1630 € MBS Recombinant Proteins mouse
GENTAUR-58bd86887d590 Mouse Bone marrow proteoglycan (Prg2) 1000ug 1630 € MBS Recombinant Proteins mouse
GENTAUR-58bd8688cff1b Mouse Bone marrow proteoglycan (Prg2) 100ug 2144 € MBS Recombinant Proteins mouse
GENTAUR-58bd86892c0bb Mouse Bone marrow proteoglycan (Prg2) 1000ug 2144 € MBS Recombinant Proteins mouse
CA75 Recombinant Human Bone Marrow Stromal Antigen 2, BST2, Tetherin, CD317 (C-6His) 50 µg 369 € novo human
MBS621103 Aggrecan G1-IGD-G2 Domains (Proteoglycan, PG, AGC 1, Aggrecan 1, Antigen identified by monoclonal A0122, Cartilage specific proteoglycan core protein, Chondroitin sulfate proteoglycan core protein 1, CSPCP, CSPG1, CSPGCP, Large aggregating proteoglycan, M Antibody 100ug 774 € MBS Polyclonals_1 human
MBS618312 Large Proteoglycan (Versican, Chondroitin Sulfate Proteoglycan Core Protein 2, CSPG2, DKFZp686K06110, ERVR, Glial Hyaluronate Binding Protein, GHAP, Large Fibroblast Proteoglycan, PGM, V1 Neo, VCAN, Versican Core Protein, Versican Proteoglycan, Versican V Antibody 50ug 680 € MBS Polyclonals_1 human
MBS613208 Osteoadherin (Osteoadherin Proteoglycan, OSAD, Keratan Sulfate Proteoglycan Osteomodulin, KSPG Osteomodulin, Osteomodulin, OMD, SLRR2C) Antibody 200ul 735 € MBS Polyclonals_1 human
abx262367 Anti-Bone Marrow Stromal Cell Antigen 2 Protein (Recombinant) 1 mg 6662 € abbex human
C892 Recombinant Human Proteoglycan 3, PRG3 (C-6His) 500 µg 1613 € novo human
T18-001-T1 anti-Matched Tumor/ Normal Human Leukemia, bone marrow Tissue Lysates (Acute Lymphoblastic Leukemia) Antibody 0,1 mg 311 € acr human