Recombinant Human Myelin Protein P0, MPZ (C-6His)

Contact us
Catalog number: C802
Price: 322 €
Supplier: ABM lentivectors
Product name: Recombinant Human Myelin Protein P0, MPZ (C-6His)
Quantity: 1.0 µg DNA
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Myelin Protein P0 is produced by our Mammalian expression system and the target gene encoding Ile30-Arg153 is expressed with a 6His tag at the C-terminus
Molecular Weight: 15, 2 kD
UniProt number: P25189
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: MPZ (C-6His), Myelin Protein P0
Short name: MPZ (C-6His), Recombinant Myelin Protein P0
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: MPZ (C-6His), sapiens Myelin Protein P0, recombinant H
Alternative technique: rec
Identity: 7225
Gene: MPZ | More about : MPZ
Long gene name: myelin protein zero
Synonyms gene: CMT1 CMT1B
Synonyms gene name: Charcot-Marie-Tooth neuropathy 1B
Synonyms: HMSNIB CMT2I CMT2J
Locus: 1q23, 3
Discovery year: 1990-04-27
GenBank acession: BC006491
Entrez gene record: 4359
Pubmed identfication: 7693129
RefSeq identity: NM_000530
Classification: V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000034341
Locus Specific Databases: Inherited Peripheral Neuropathies Mutation Database LRG_256

Related Products :

MBS617497 Myelin Protein Zero (MPZ, CHM, CMT1, CMT1B, CMT2I, CMT2J, CMT4E, CMTDI3, DSS, HMSNIB, Myelin Glycoprotein P-Zero, Myelin P0 Protein Precursor, Myelin Peripheral Protein, Myelin Protein Peripheral, MPP, Myelin Protein Zero (Charcot-Marie-Tooth Neuropathy 1 Antibody 0.25 ml 669 € MBS Polyclonals_1 human
C802 Recombinant Human Myelin Protein P0, MPZ (C-6His) 50 µg 496 € novo human
abx571869 Anti-Human Protein Zero, Myelin (MPZ) ELISA Kit 96 tests 731 € abbex human
DL-MPZ-Hu Human Protein Zero, Myelin MPZ ELISA Kit 96T 846 € DL elisas human
GENTAUR-58bdc1990d9da Anti- Protein Zero, Myelin (MPZ) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdc1997cc5d Anti- Protein Zero, Myelin (MPZ) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdd201ad248 Anti- Protein Zero, Myelin (MPZ) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdd7d5c078c Anti- Protein Zero, Myelin (MPZ) Antibody 100ug 520 € MBS Polyclonals human
AE33045HO-48 ELISA test for Horse Myelin protein P0 (MPZ) 1x plate of 48 wells 402 € abebio horse
GENTAUR-58bcef45d52c9 Heterodontus francisci Myelin protein P0 (mpz) 100ug 1426 € MBS Recombinant Proteins human
GENTAUR-58bcef4740b87 Heterodontus francisci Myelin protein P0 (mpz) 1000ug 1426 € MBS Recombinant Proteins human
GENTAUR-58bcef4775d1b Heterodontus francisci Myelin protein P0 (mpz) 100ug 1929 € MBS Recombinant Proteins human
GENTAUR-58bcef4832f85 Heterodontus francisci Myelin protein P0 (mpz) 1000ug 1929 € MBS Recombinant Proteins human
AE33045HO Horse Myelin protein P0 (MPZ) ELISA Kit 48 wells plate 500 € ab-elisa elisas horse
AE33045HO-96 Horse Myelin protein P0 (MPZ) ELISA Kit 1x plate of 96 wells 671 € abebio horse
EKU06956 Protein Zero, Myelin (MPZ) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
EKU06957 Protein Zero, Myelin (MPZ) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
GENTAUR-58b8e403bbe76 Xenopus laevis Myelin protein P0 (mpz) 100ug 1431 € MBS Recombinant Proteins xenopus
GENTAUR-58b8e40432b12 Xenopus laevis Myelin protein P0 (mpz) 1000ug 1431 € MBS Recombinant Proteins xenopus
GENTAUR-58b8e40484084 Xenopus laevis Myelin protein P0 (mpz) 100ug 1934 € MBS Recombinant Proteins xenopus
GENTAUR-58b8e4051a95e Xenopus laevis Myelin protein P0 (mpz) 1000ug 1934 € MBS Recombinant Proteins xenopus
GENTAUR-58b9e01f76b0e Xenopus laevis Myelin protein P0 (mpz) 100ug 1431 € MBS Recombinant Proteins xenopus
GENTAUR-58b9e02053f9a Xenopus laevis Myelin protein P0 (mpz) 1000ug 1431 € MBS Recombinant Proteins xenopus
GENTAUR-58b9e020a0999 Xenopus laevis Myelin protein P0 (mpz) 100ug 1934 € MBS Recombinant Proteins xenopus
GENTAUR-58b9e020ddce4 Xenopus laevis Myelin protein P0 (mpz) 1000ug 1934 € MBS Recombinant Proteins xenopus
C238 Recombinant Human Myelin P2 Protein, PMP2 (N-6His) 500 µg 1613 € novo human
CI85 Recombinant Human Myelin Protein P0-like 1, MPZL1 (C-6His) 500 µg 709 € novo human
C897 Recombinant Human Myelin-Associated Glycoprotein, MAG, Siglec-4a (C-6His) 50 µg 369 € novo human
C565 Recombinant Human Myelin Oligodendrocyte Glycoprotein, MOG (C-6His) 50 µg 369 € novo human
LV227042 MPZ Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human