| Catalog number: | C785 |
|---|---|
| Price: | 333 € |
| Supplier: | Bioss Primary Conjugated Antibodies |
| Product name: | Recombinant Human CDK2AP2 (C-6His) |
| Quantity: | 0.1ml |
| Other quantities: | 10 µg 100€ 50 µg 156€ 500 µg 709€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human CDK2AP2 is produced by our Mammalian expression system and the target gene encoding Met1-Thr126 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: | 1 kD, 14 |
| UniProt number: | O75956 |
| State of the product: | Freeze-dried |
| Shipping conditions: | Ambient temperature |
| Formulation: | 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNARTVDHHHHHH |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | CDK2AP2 (C-6His) |
| Short name: | Recombinant CDK2AP2 (C-6His) |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | sapiens CDK2AP2 (C-6His), recombinant H |
| Alternative technique: | rec |
| Identity: | 30833 |
| Gene: | CDK2AP2 | More about : CDK2AP2 |
| Long gene name: | cyclin dependent kinase 2 associated protein 2 |
| Synonyms gene name: | CDK2-associated protein 2 |
| Synonyms: | DOC-1R p14 |
| Synonyms name: | tumor suppressor deleted in oral cancer related 1 |
| Locus: | 11q13, 2 |
| Discovery year: | 2005-04-07 |
| GenBank acession: | AF089814 |
| Entrez gene record: | 10263 |
| Pubmed identfication: | 10082655 |
| RefSeq identity: | NM_005851 |
| Havana BLAST/BLAT: | OTTHUMG00000167676 |
| C785 | Recombinant Human CDK2AP2 (C-6His) | 10 µg | 100 € | novo | human |
| GWB-PPAT30 | Human CDK2AP2 Recombinant Protein | bulk | Ask price € | genways bulk | human |
| RP-0389H | Recombinant Human CDK2AP2 Protein (His Tag) | 20μg | 572 € | adv | human |
| LV114362 | CDK2AP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| LV114363 | CDK2AP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| LV114364 | CDK2AP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| LV114365 | CDK2AP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| LV114367 | CDK2AP2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| LV114366 | CDK2AP2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| AR50692PU-N | anti-CDK2AP2 (1-126, His-tag) Antibody | 0,5 mg | 1109 € | acr | human |
| AR50692PU-S | anti-CDK2AP2 (1-126, His-tag) Antibody | 0,1 mg | 485 € | acr | human |
| C10199-1 | anti-CDK2AP2 Antibody | 50 Вµg | 347 € | acr | human |
| C10199-2 | anti-CDK2AP2 Antibody | 0,1 mg | 500 € | acr | human |
| GENTAUR-58be118e84309 | Anti- CDK2AP2 Antibody | 0.12 ml | 348 € | MBS Polyclonals | human |
| GENTAUR-58be118ef1000 | Anti- CDK2AP2 Antibody | 0.06 ml | 265 € | MBS Polyclonals | human |
| GENTAUR-58be65e03662b | Anti-CDK2AP2 (Polyclonal), ALEXA Fluor 594 | 100 microliters | 489 € | Bioss Polyclonal Antibodies | human |
| abx911274 | Anti-CDK2AP2 siRNA | inquire | 50 € | abbex | human |
| abx911275 | Anti-CDK2AP2 siRNA | 15 nmol | 528 € | abbex | human |
| bs-7995R-A350 | CDK2AP2 Antibody, ALEXA FLUOR 350 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-7995R-A488 | CDK2AP2 Antibody, ALEXA FLUOR 488 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-7995R-A555 | CDK2AP2 Antibody, ALEXA FLUOR 555 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-7995R-A594 | CDK2AP2 Antibody, ALEXA FLUOR 594 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-7995R-A647 | CDK2AP2 Antibody, ALEXA FLUOR 647 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-7995R-Biotin | CDK2AP2 Antibody, Biotin Conjugated | 0.1ml | 333 € | Bioss Primary Conjugated Antibodies | human |
| bs-7995R | CDK2AP2 Antibody | 0.1ml | 263 € | Bioss Primary Unconjugated Antibodies | human |
| bs-7995R-Cy3 | CDK2AP2 Antibody, Cy3 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-7995R-Cy5 | CDK2AP2 Antibody, Cy5 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-7995R-Cy5.5 | CDK2AP2 Antibody, Cy5.5 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-7995R-Cy7 | CDK2AP2 Antibody, Cy7 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-7995R-FITC | CDK2AP2 Antibody, FITC Conjugated | 0.1ml | 333 € | Bioss Primary Conjugated Antibodies | human |