Recombinant Human CDK2AP2 (C-6His)

Catalog number:	C785 Buy Now
Price:	333 €
Supplier:	Bioss Primary Conjugated Antibodies
Product name:	Recombinant Human CDK2AP2 (C-6His)
Quantity:	0.1ml
Other quantities:	1 mg 1115€ 10 µg 100€ 50 µg 156€
Related search:	human gene recombinant sapiens synonyms identity details

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human CDK2AP2 is produced by our Mammalian expression system and the target gene encoding Met1-Thr126 is expressed with a 6His tag at the C-terminus
Molecular Weight:	1 kD, 14
UniProt number:	O75956
State of the product:	Freeze-dried
Shipping conditions:	Ambient temperature
Formulation:	2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations:	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution:	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNARTVDHHHHHH
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	CDK2AP2 (C-6His)
Short name:	Recombinant CDK2AP2 (C-6His)
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	sapiens CDK2AP2 (C-6His), recombinant H
Alternative technique:	rec
Identity:	30833
Gene:	CDK2AP2 | More about : CDK2AP2
Long gene name:	cyclin dependent kinase 2 associated protein 2
Synonyms gene name:	CDK2-associated protein 2
Synonyms:	DOC-1R p14
Synonyms name:	tumor suppressor deleted in oral cancer related 1
Locus:	11q13, 2
Discovery year:	2005-04-07
GenBank acession:	AF089814
Entrez gene record:	10263
Pubmed identfication:	10082655
RefSeq identity:	NM_005851
Havana BLAST/BLAT:	OTTHUMG00000167676

• #human
• #gene
• #recombinant
• #sapiens
• #synonyms
• #identity
• #details