| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Growth Differentiation Factor 8 is produced by our Mammalian expression system and the target gene encoding Asn25-Ser265 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
28, 4 kD |
| UniProt number: |
O08689 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
NEGSEREENVEKEGLCNACAWRQNTRYSRIEAIKIQILSKLRLETAPNISKDAIRQLLPRAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQADGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMSPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
GDF-8 (C-6His), MSTN, Myostatin |
| Short name: |
GDF-8 (C-6His), MSTN, Recombinant Mouse Myostatin |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
GDF-8 (C-6His), myostatin, recombinant Mouse Myostatin |
| Alternative technique: |
rec |
| Alternative to gene target: |
DNA-templated and biological process this GO :0048632 and negative regulation of skeletal muscle tissue growth and biological process this GO :0051384 and response to glucocorticoid and biological process this GO :0051602 and response to electrical stimulus and biological process this GO :0071549 and cellular response to dexamethasone stimulus and biological process, Extracellular, GDF8 and MSLHP, MSTN and IDBG-639462 and ENSBTAG00000011808 and 281187, MSTN and IDBG-77438 and ENSG00000138379 and 2660, Mstn and IDBG-153903 and ENSMUSG00000026100 and 17700, identical protein binding, this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007517 and muscle organ development and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008201 and heparin binding and molecular function this GO :0009408 and response to heat and biological process this GO :0009629 and response to gravity and biological process this GO :0014732 and skeletal muscle atrophy and biological process this GO :0014741 and negative regulation of muscle hypertrophy and biological process this GO :0014850 and response to muscle activity and biological process this GO :0022602 and ovulation cycle process and biological process this GO :0033574 and response to testosterone and biological process this GO :0040007 and growth and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043403 and skeletal muscle tissue regeneration and biological process this GO :0043627 and response to estrogen and biological process this GO :0045471 and response to ethanol and biological process this GO :0045893 and positive regulation of transcription, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0008201 : heparin binding and also this GO :0042802 : identical protein binding, this GO :0005125 : cytokine activity, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0008201 : heparin binding, this GO :0042802 : identical protein binding, myostatin |
| Identity: |
4223 |
| Gene: |
MSTN |
More about : MSTN |
| Long gene name: |
myostatin |
| Synonyms gene: |
GDF8 |
| Synonyms gene name: |
growth differentiation factor 8 |
| Locus: |
2q32, 2 |
| Discovery year: |
1997-09-12 |
| GenBank acession: |
AF019627 |
| Entrez gene record: |
2660 |
| Pubmed identfication: |
9288100 10610713 17003236 |
| RefSeq identity: |
NM_005259 |
| Havana BLAST/BLAT: |
OTTHUMG00000132663 |
| Locus Specific Databases: |
Leiden Muscular Dystrophy pages LRG_200 |