| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human DC-SIGN is produced by our Mammalian expression system and the target gene encoding Lys62-Ala404 is expressed with a Fc tag at the N-terminus |
| Molecular Weight: |
64, 7 kD |
| UniProt number: |
Q9NNX6 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD209 CD209 (N-Fc) |
| Short name: |
CD209 (N-Fc), Recombinant CD209 Antigen |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD209 molecule (N-fragment c), sapiens CD209 molecule protein, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD209 and IDBG-23414 and ENSG00000090659 and 30835, Plasma membranes, metal ion binding, this GO :0005515 and protein binding and molecular function this GO :0005537 and mannose binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006897 and endocytosis and biological process this GO :0007157 and heterophilic cell-cell adhesion and biological process this GO :0007159 and leukocyte cell-cell adhesion and biological process this GO :0009988 and cell-cell recognition and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0019048 and modulation by virus of host morphology or physiology and biological process this GO :0019062 and virion attachment to host cell and biological process this GO :0019079 and viral genome replication and biological process this GO :0019882 and antigen processing and presentation and biological process this GO :0030246 and carbohydrate binding and molecular function this GO :0035556 and intracellular signal transduction and biological process this GO :0042129 and regulation of T cell proliferation and biological process this GO :0042605 and peptide antigen binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0046790 and virion binding and molecular function this GO :0046872 and metal ion binding and molecular function this GO :0046968 and peptide antigen transport and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0075733 and intracellular transport of virus and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0005537 : mannose binding and also this GO :0030246 : carbohydrate binding and also this GO :0042605 : peptide antigen binding and also this GO :0046790 : virion binding and also this GO :0046872 : metal ion binding, this GO :0005537 : mannose binding, this GO :0030246 : carbohydrate binding, this GO :0042605 : peptide antigen binding, this GO :0046790 : virion binding, this GO :0046872 : metal ion binding, CD209 molecule |
| Identity: |
1641 |
| Gene: |
CD209 |
More about : CD209 |
| Long gene name: |
CD209 molecule |
| Synonyms gene name: |
CD209 antigen |
| Synonyms: |
DC-SIGN CDSIGN DC-SIGN1 CLEC4L |
| Locus: |
19p13, 2 |
| Discovery year: |
2000-07-19 |
| GenBank acession: |
M98457 |
| Entrez gene record: |
30835 |
| Pubmed identfication: |
1518869 |
| RefSeq identity: |
NM_021155 |
| Classification: |
CD molecules Scavenger receptors C-type lectin domain family |
| Havana BLAST/BLAT: |
OTTHUMG00000182530 |