Recombinant Human CD209 Antigen, CD209 (N-Fc)

Contact us
Catalog number: C769
Price: 517 €
Supplier: ABM lentivectors
Product name: Recombinant Human CD209 Antigen, CD209 (N-Fc)
Quantity: 1.0 µg DNA
Other quantities: 1 mg 2283€ 10 µg 146€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human DC-SIGN is produced by our Mammalian expression system and the target gene encoding Lys62-Ala404 is expressed with a Fc tag at the N-terminus
Molecular Weight: 64, 7 kD
UniProt number: Q9NNX6
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD209 CD209 (N-Fc)
Short name: CD209 (N-Fc), Recombinant CD209 Antigen
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD209 molecule (N-fragment c), sapiens CD209 molecule protein, recombinant H
Alternative technique: rec
Alternative to gene target: CD209 and IDBG-23414 and ENSG00000090659 and 30835, Plasma membranes, metal ion binding, this GO :0005515 and protein binding and molecular function this GO :0005537 and mannose binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006897 and endocytosis and biological process this GO :0007157 and heterophilic cell-cell adhesion and biological process this GO :0007159 and leukocyte cell-cell adhesion and biological process this GO :0009988 and cell-cell recognition and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0019048 and modulation by virus of host morphology or physiology and biological process this GO :0019062 and virion attachment to host cell and biological process this GO :0019079 and viral genome replication and biological process this GO :0019882 and antigen processing and presentation and biological process this GO :0030246 and carbohydrate binding and molecular function this GO :0035556 and intracellular signal transduction and biological process this GO :0042129 and regulation of T cell proliferation and biological process this GO :0042605 and peptide antigen binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0046790 and virion binding and molecular function this GO :0046872 and metal ion binding and molecular function this GO :0046968 and peptide antigen transport and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0075733 and intracellular transport of virus and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0005537 : mannose binding and also this GO :0030246 : carbohydrate binding and also this GO :0042605 : peptide antigen binding and also this GO :0046790 : virion binding and also this GO :0046872 : metal ion binding, this GO :0005537 : mannose binding, this GO :0030246 : carbohydrate binding, this GO :0042605 : peptide antigen binding, this GO :0046790 : virion binding, this GO :0046872 : metal ion binding, CD209 molecule
Identity: 1641
Gene: CD209 | More about : CD209
Long gene name: CD209 molecule
Synonyms gene name: CD209 antigen
Synonyms: DC-SIGN CDSIGN DC-SIGN1 CLEC4L
Locus: 19p13, 2
Discovery year: 2000-07-19
GenBank acession: M98457
Entrez gene record: 30835
Pubmed identfication: 1518869
RefSeq identity: NM_021155
Classification: CD molecules Scavenger receptors C-type lectin domain family
Havana BLAST/BLAT: OTTHUMG00000182530

Related Products :

C769 Recombinant Human CD209 Antigen, CD209 (N-Fc) 50 µg 303 € novo human
GENTAUR-58bd8d9e9de71 Human CD209 antigen (CD209) 100ug 1989 € MBS Recombinant Proteins human
GENTAUR-58bd8d9f1243f Human CD209 antigen (CD209) 1000ug 1989 € MBS Recombinant Proteins human
GENTAUR-58bd8d9f6f2e2 Human CD209 antigen (CD209) 100ug 2503 € MBS Recombinant Proteins human
GENTAUR-58bd8d9fdfddb Human CD209 antigen (CD209) 1000ug 2503 € MBS Recombinant Proteins human
GENTAUR-58bd9a1adfffb Hylobates syndactylus CD209 antigen (CD209) 100ug 1929 € MBS Recombinant Proteins human
GENTAUR-58bd9a1b43377 Hylobates syndactylus CD209 antigen (CD209) 1000ug 1929 € MBS Recombinant Proteins human
GENTAUR-58bd9a1bc9bc9 Hylobates syndactylus CD209 antigen (CD209) 100ug 2442 € MBS Recombinant Proteins human
GENTAUR-58bd9a1c30f84 Hylobates syndactylus CD209 antigen (CD209) 1000ug 2442 € MBS Recombinant Proteins human
MBS620009 CD1c (Cluster of differentiation antigen 1c, CD1c antigen, CD1c antigen c polypeptide, CD1c molecule, Cortical thymocyte antigen CD1c, Differentiation antigen CD1 alpha 3, R7, T cell surface glycoprotein CD1c) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS620858 Dystonin (230kD bullous pemphigoid antigen, BP240, BPA, BPAG1, Bullous pemphigoid antigen, Bullous pemphigoid antigen 1, isoform 7, Bullous pemphigoid antigen 1, isoforms 1/2/3/4/5/8, Bullous pemphigoid antigen 1, Isoforms 6/9/10, CATX-15, D6S1101, DKFZp5 Antibody 100ug 663 € MBS Polyclonals_1 human
MBS623603 MAGEA6, CT (Melanoma-associated Antigen 6, MAGE-6 Antigen, MAGE-3B Antigen, Cancer/Testis Antigen 1.6, CT1.6, MAGE6) Antibody 200ul 603 € MBS Polyclonals_1 human
abx255134 Anti-Mouse CD209 antigen-like protein A ELISA Kit 96 tests 659 € abbex mouse
RP-0537H Recombinant Human DC-SIGN / CD209 Protein (Fc Tag) 50μg 624 € adv human
RP-1037RC Recombinant Rhesus DC-SIGN / CD209 Protein (Fc Tag) 50μg 624 € adv rhesus
RP-1036RC Recombinant Rhesus DC-SIGN / CD209 Protein(His Tag) 50μg 624 € adv rhesus
MBS623630 Epstein Barr Virus, Nuclear Antigen (Epstein-Barr Nuclear Antigen 1, EBV Nuclear Antigen 1, EBNA1, EBNA-1, EBV, BKRF1, Human Herpesvirus 4, HHV4) (Biotin) 1 mililiter 724 € MBS Polyclonals_1 human
MBS620547 CD157 (BST1, bone marrow stromal cell antigen 1, ADP-ribosyl cyclase 2 precursor, Bone marrow stromal antigen 1, BST-1, cADPr hydrolase 2, CD157 antigen, Cyclic ADP-ribose hydrolase 2) (Biotin) 50ug 818 € MBS Polyclonals_1 human
GWB-C58FCA Integrin B 2 (antigen CD18 (p95) Lymphocyte Function-associated Antigen 1; Macrophage Antigen 1 (mac-1) B Subunit) (ITGB 1 vial 602 € genways human
MBS623947 MAGEA11, NT (Melanoma-associated Antigen 11, MAGE-11 Antigen, Cancer/Testis Antigen 1.11, CT1.10, MAGE11) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS624255 MAGEA9, ID (Melanoma-associated Antigen 9, MAGE-9 Antigen, Cancer/Testis Antigen 1.9, CT1.9, MAGE9, MAGEA9A) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS615685 Nova 1 RNA Binding Protein (Euro-oncological ventral antigen 1, Neuro-oncological ventral antigen 1, Nova-1, Onconeural ventral antigen-1, Paraneoplastic Ri antigen, Ventral neuron-specific protein 1) Antibody 100ul 713 € MBS Polyclonals_1 human
101-M295 Anti-Human CD209 100ug 336 € Reliatech antibodies human
MBS221651 Anti-HUMAN CD209 Antibody 100ug 741 € MBS Polyclonals_1 human
MBS240451 Anti-Human CD209 / DC-SIGN 50ug 597 € MBS Polyclonals_1 human
YSRTMCA2318F CD209, Clone: MR-1, Mouse Monoclonal antibody-Human; flow: FITC 0.1 mg 404 € accurate-monoclonals human
YSRTMCA2318EL CD209, Clone: MR-1, Mouse Monoclonal antibody-Human; flow/IF/functional assays: Low Endotoxin 0.5 mg 617 € accurate-monoclonals human
YSRTMCA2318B CD209, DC-SIGN, Clone: MR-1, Mouse Monoclonal antibody-Human; flow: Biotin 0.1 mg 432 € accurate-monoclonals human
YSRTMCA2318 CD209, DC-SIGN, Clone: MR-1, Mouse Monoclonal antibody-Human; flow/IF 200ug 462 € accurate-monoclonals human
LV113055 CD209 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 517 € ABM lentivectors human