| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human BOC is produced by our Mammalian expression system and the target gene encoding Asp31-Ser157 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
14, 2 kD |
| UniProt number: |
Q96DN7 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
DLNEVPQVTVQPASTVQKPGGTVILGCVVEPPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLASESAPLPPCHGAVPPHLSHPEAPTIHAASCYSVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
BOC (C-6His), BOC Protein |
| Short name: |
BOC (C-6His), Recombinant BOC Protein |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
Boc homolog (mouse) (C-6His), sapiens Boc homolog (mouse) Protein, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BOC and IDBG-50192 and ENSG00000144857 and 91653, BOC and IDBG-632359 and ENSBTAG00000013909 and 512018, Boc and IDBG-162156 and ENSMUSG00000022687 and 117606, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007224 and smoothened signaling pathway and biological process this GO :0007411 and axon guidance and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0030030 and cell projection organization and biological process this GO :0030424 and axon and cellular component this GO :0030426 and growth cone and cellular component this GO :0042692 and muscle cell differentiation and biological process this GO :0043025 and neuronal cell body and cellular component this GO :0044295 and axonal growth cone and cellular component this GO :0045663 and positive regulation of myoblast differentiation and biological process this GO :0051149 and positive regulation of muscle cell differentiation and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, Boc homolog (mouse) |
| Identity: |
17173 |
| Gene: |
BOC |
More about : BOC |
| Long gene name: |
BOC cell adhesion associated, oncogene regulated |
| Synonyms gene name: |
Boc homolog (mouse) |
| Synonyms: |
CDON2 |
| Synonyms name: |
brother of CDO brother of CDON cell adhesion associated, oncogene regulated 2 |
| Locus: |
3q13, 2 |
| Discovery year: |
2006-02-02 |
| GenBank acession: |
AY027658 |
| Entrez gene record: |
91653 |
| Pubmed identfication: |
11782431 |
| RefSeq identity: |
NM_033254 |
| Classification: |
I-set domain containing Immunoglobulin like domain containing Fibronectin type III domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000159305 |