Recombinant Human Teratocarcinoma-Derived Growth Factor 1, TDGF1, Cripto (C-Fc)

Contact us
Catalog number: C762
Price: 688 €
Supplier: acr
Product name: Recombinant Human Teratocarcinoma-Derived Growth Factor 1, TDGF1, Cripto (C-Fc)
Quantity: 1 ml
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Teratocarcinoma-derived growth factor 1 is produced by our Mammalian expression system and the target gene encoding Leu31-Ser169 is expressed with a Fc tag at the C-terminus
Molecular Weight: 42, 8 kD
UniProt number: P13385
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Cripto (C-Fc), TDGF1, Teratocarcinoma-Derived Growth Factor 1
Short name: Cripto (C-Fc), TDGF1, Recombinant Teratocarcinoma-Derived Growth Factor 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: Cripto (C-fragment c), sapiens Teratocarcinoma-Derived Growth Factor 1, teratocarcinoma-derived growth factor 1, recombinant H
Alternative technique: rec
Alternative to gene target: CR and CRGF and CRIPTO, TDGF1 and IDBG-409017 and ENSG00000241186 and 6997, Tdgf1 and IDBG-202568 and ENSMUSG00000032494 and 21667, embryo and biological process this GO :0009790 and embryo development and biological process this GO :0009948 and anterior/posterior axis specification and biological process this GO :0009966 and regulation of signal transduction and biological process this GO :0009986 and cell surface and cellular component this GO :0010595 and positive regulation of endothelial cell migration and biological process this GO :0016324 and apical plasma membrane and cellular component this GO :0018105 and peptidyl-serine phosphorylation and biological process this GO :0019897 and extrinsic component of plasma membrane and cellular component this GO :0030154 and cell differentiation and biological process this GO :0030334 and regulation of cell migration and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0030509 and BMP signaling pathway and biological process this GO :0030512 and negative regulation of transforming growth factor beta receptor signaling pathway and biological process this GO :0030879 and mammary gland development and biological process this GO :0031225 and anchored component of membrane and cellular component this GO :0035729 and cellular response to hepatocyte growth factor stimulus and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0044344 and cellular response to fibroblast growth factor stimulus and biological process this GO :0045121 and membrane raft and cellular component this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048146 and positive regulation of fibroblast proliferation and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0055007 and cardiac muscle cell differentiation and biological process this GO :0060070 and canonical Wnt signaling pathway and biological process this GO :0071346 and cellular response to interferon-gamma and biological process this GO :0071354 and cellular response to interleukin-6 and biological process this GO :0071356 and cellular response to tumor necrosis factor and biological process this GO :0071364 and cellular response to epidermal growth factor stimulus and biological process, growth factor activity, nuclei, this GO :0000187 and activation of MAPK activity and biological process this GO :0001570 and vasculogenesis and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0001763 and morphogenesis of a branching structure and biological process this GO :0001954 and positive regulation of cell-matrix adhesion and biological process this GO :0002042 and cell migration involved in sprouting angiogenesis and biological process this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0007369 and gastrulation and biological process this GO :0007507 and heart development and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008595 and anterior/posterior axis specification, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, teratocarcinoma-derived growth factor 1
Identity: 11701
Gene: TDGF1 | More about : TDGF1
Long gene name: teratocarcinoma-derived growth factor 1
Synonyms: CRIPTO CR Cripto-1
Locus: 3p21, 31
Discovery year: 1990-08-02
GenBank acession: M96955
Entrez gene record: 6997
Pubmed identfication: 1882841 10393436
RefSeq identity: NM_003212

Related Products :

MBS624351 CRIPTO, CT (Teratocarcinoma-derived Growth Factor 1, Epidermal Growth Factor-like Cripto Protein CR1, Cripto-1 Growth Factor, CRGF, TDGF1) Antibody 200ul 597 € MBS Polyclonals_1 human
MBS611191 Cripto (CRGF, Cripto-1 Growth Factor, Cripto-3, TDGF1, TDGF2, Teratocarcinoma-derived growth factor 1) Antibody 100ul 630 € MBS Polyclonals_1 human
GENTAUR-58be31b567a1f Cripto-1 (Epidermal Growth Factor-Like Cripto Protein CR1, TDGF-1, Teratocarcinoma-Derived Growth Factor 1, CFC-2) 500ug 730 € MBS mono human
GENTAUR-58be31b4d4223 Cripto-1 (Epidermal Growth Factor-Like Cripto Protein CR1, TDGF-1, Teratocarcinoma-Derived Growth Factor 1, CFC-2) Antibody 500ug 730 € MBS mono human
C762 Recombinant Human Teratocarcinoma-Derived Growth Factor 1, TDGF1, Cripto (C-Fc) 10 µg 202 € novo human
DL-TDGF1-Hu Human Teratocarcinoma Derived Growth Factor 1 TDGF1 ELISA Kit 96T 846 € DL elisas human
EKU07597 Teratocarcinoma Derived Growth Factor 1 (TDGF1) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
RP-2104R Recombinant Rat Cripto / TDGF1 Protein (Fc Tag) 10μg 572 € adv rat
abx190213 Anti-Human Teratocarcinoma Derived Growth Factor 1 CLIA Kit 96 tests 1079 € abbex human
abx250547 Anti-Human Teratocarcinoma-derived growth factor 1 ELISA Kit 96 tests 557 € abbex human
GENTAUR-58bd29942d5fb Human Putative teratocarcinoma-derived growth factor 3 (TDGF1P3) 100ug 1597 € MBS Recombinant Proteins human
GENTAUR-58bd29947d1bb Human Putative teratocarcinoma-derived growth factor 3 (TDGF1P3) 1000ug 1597 € MBS Recombinant Proteins human
GENTAUR-58bd2994cd3e9 Human Putative teratocarcinoma-derived growth factor 3 (TDGF1P3) 100ug 2100 € MBS Recombinant Proteins human
GENTAUR-58bd299530d80 Human Putative teratocarcinoma-derived growth factor 3 (TDGF1P3) 1000ug 2100 € MBS Recombinant Proteins human
GENTAUR-58bd585a9b5b0 human Teratocarcinoma-derived growth factor 1 0.05 mg 265 € MBS Recombinant Proteins human
GENTAUR-58bd585ad47dc human Teratocarcinoma-derived growth factor 1 0.5 mg 951 € MBS Recombinant Proteins human
GENTAUR-58bd585b2cd4d human Teratocarcinoma-derived growth factor 1 0.2 mg 564 € MBS Recombinant Proteins human
GENTAUR-58bd585b723a7 human Teratocarcinoma-derived growth factor 1 1 mg 1475 € MBS Recombinant Proteins human
abx254452 Anti-Mouse Teratocarcinoma Derived Growth Factor 1 ELISA Kit 96 tests 557 € abbex mouse
abx256036 Anti-Rat Teratocarcinoma Derived Growth Factor 1 ELISA Kit inquire 50 € abbex rat
GENTAUR-58bd574cca9e2 Anti- Teratocarcinoma-derived growth factor 1 Antibody 100ug 310 € MBS Polyclonals human
GENTAUR-58bd573a77614 Anti- Teratocarcinoma-derived growth factor 1 _x000D_ Antibody 100ug 310 € MBS Polyclonals human
MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
PRO-50022-0010 anti-TDGF1 / CRIPTO (1-188) Antibody 10 Вµg 268 € acr human
PRO-50022-0025 anti-TDGF1 / CRIPTO (1-188) Antibody 25 Вµg 355 € acr human
PRO-50022-0050 anti-TDGF1 / CRIPTO (1-188) Antibody 50 Вµg 514 € acr human
AM06616SU-N anti-TDGF1 / CRIPTO Antibody 0,1 ml 674 € acr human
AP09364PU-S anti-TDGF1 / CRIPTO Antibody 25 Вµl 326 € acr human
AP15504PU-M anti-TDGF1 / CRIPTO Antibody 0,5 ml 572 € acr human
AP15504PU-N anti-TDGF1 / CRIPTO Antibody 1 ml 688 € acr human