| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Teratocarcinoma-derived growth factor 1 is produced by our Mammalian expression system and the target gene encoding Leu31-Ser169 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
42, 8 kD |
| UniProt number: |
P13385 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
Cripto (C-Fc), TDGF1, Teratocarcinoma-Derived Growth Factor 1 |
| Short name: |
Cripto (C-Fc), TDGF1, Recombinant Teratocarcinoma-Derived Growth Factor 1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
Cripto (C-fragment c), sapiens Teratocarcinoma-Derived Growth Factor 1, teratocarcinoma-derived growth factor 1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CR and CRGF and CRIPTO, TDGF1 and IDBG-409017 and ENSG00000241186 and 6997, Tdgf1 and IDBG-202568 and ENSMUSG00000032494 and 21667, embryo and biological process this GO :0009790 and embryo development and biological process this GO :0009948 and anterior/posterior axis specification and biological process this GO :0009966 and regulation of signal transduction and biological process this GO :0009986 and cell surface and cellular component this GO :0010595 and positive regulation of endothelial cell migration and biological process this GO :0016324 and apical plasma membrane and cellular component this GO :0018105 and peptidyl-serine phosphorylation and biological process this GO :0019897 and extrinsic component of plasma membrane and cellular component this GO :0030154 and cell differentiation and biological process this GO :0030334 and regulation of cell migration and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0030509 and BMP signaling pathway and biological process this GO :0030512 and negative regulation of transforming growth factor beta receptor signaling pathway and biological process this GO :0030879 and mammary gland development and biological process this GO :0031225 and anchored component of membrane and cellular component this GO :0035729 and cellular response to hepatocyte growth factor stimulus and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0044344 and cellular response to fibroblast growth factor stimulus and biological process this GO :0045121 and membrane raft and cellular component this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048146 and positive regulation of fibroblast proliferation and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0055007 and cardiac muscle cell differentiation and biological process this GO :0060070 and canonical Wnt signaling pathway and biological process this GO :0071346 and cellular response to interferon-gamma and biological process this GO :0071354 and cellular response to interleukin-6 and biological process this GO :0071356 and cellular response to tumor necrosis factor and biological process this GO :0071364 and cellular response to epidermal growth factor stimulus and biological process, growth factor activity, nuclei, this GO :0000187 and activation of MAPK activity and biological process this GO :0001570 and vasculogenesis and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0001763 and morphogenesis of a branching structure and biological process this GO :0001954 and positive regulation of cell-matrix adhesion and biological process this GO :0002042 and cell migration involved in sprouting angiogenesis and biological process this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0007369 and gastrulation and biological process this GO :0007507 and heart development and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008595 and anterior/posterior axis specification, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, teratocarcinoma-derived growth factor 1 |
| Identity: |
11701 |
| Gene: |
TDGF1 |
More about : TDGF1 |
| Long gene name: |
teratocarcinoma-derived growth factor 1 |
| Synonyms: |
CRIPTO CR Cripto-1 |
| Locus: |
3p21, 31 |
| Discovery year: |
1990-08-02 |
| GenBank acession: |
M96955 |
| Entrez gene record: |
6997 |
| Pubmed identfication: |
1882841 10393436 |
| RefSeq identity: |
NM_003212 |