Recombinant Human Serine Protease HTRA2, HTRA2, Omi (C-6His)

Contact us
Catalog number: C760
Price: 332 €
Supplier: Bioss Primary Conjugated Antibodies.
Product name: Recombinant Human Serine Protease HTRA2, HTRA2, Omi (C-6His)
Quantity: 100ul
Other quantities: 1 mg 1115€ 10 µg 100€ 500 µg 709€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human HTRA2 is produced by our Mammalian expression system and the target gene encoding Ala134-Glu458 is expressed with a 6His tag at the C-terminus
Molecular Weight: 36 kD
UniProt number: O43464
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, 5, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTEVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: HTRA2, Omi (C-6His), Serine Protease HTRA2
Short name: HTRA2, Omi (C-6His), Recombinant Serine Protease HTRA2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: HtrA serine peptidase 2, Omi (C-6His), sapiens Serine Protease HtrA serine peptidase 2, recombinant H
Alternative technique: rec
Alternative to gene target: HTRA2 and IDBG-57753 and ENSG00000115317 and 27429, HTRA2 and IDBG-631258 and ENSBTAG00000020124 and 523039, Htra2 and IDBG-159586 and ENSMUSG00000068329 and 64704, nuclei, this GO :0000785 and chromatin and cellular component this GO :0003824 and catalytic activity and molecular function this GO :0004252 and serine-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005758 and mitochondrial intermembrane space and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0005829 and cytosol and cellular component this GO :0005856 and cytoskeleton and cellular component this GO :0006508 and proteolysis and biological process this GO :0006672 and ceramide metabolic process and biological process this GO :0007005 and mitochondrion organization and biological process this GO :0007628 and adult walking behavior and biological process this GO :0008233 and peptidase activity and molecular function this GO :0008236 and serine-type peptidase activity and molecular function this GO :0008344 and adult locomotory behavior and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0009635 and response to herbicide and biological process this GO :0009898 and cytoplasmic side of plasma membrane and cellular component this GO :0010942 and positive regulation of cell death and biological process this GO :0016020 and membrane and cellular component this GO :0016540 and protein autoprocessing and biological process this GO :0019742 and pentacyclic triterpenoid metabolic process and biological process this GO :0030900 and forebrain development and biological process this GO :0031966 and mitochondrial membrane and cellular component this GO :0034605 and cellular response to heat and biological process this GO :0035631 and CD40 receptor complex and cellular component this GO :0040014 and regulation of multicellular organism growth and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043280 and positive regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0045786 and negative regulation of cell cycle and biological process this GO :0048666 and neuron development and biological process this GO :0051082 and unfolded protein binding and molecular function this GO :0060548 and negative regulation of cell death and biological process this GO :0071363 and cellular response to growth factor stimulus and biological process this GO :0097193 and intrinsic apoptotic signaling pathway and biological process this GO :0097194 and execution phase of apoptosis and biological process this GO :2001241 and positive regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process this GO :2001269 and positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway and biological process, this GO :0003824 : catalytic activity, this GO :0003824 : catalytic activity and also this GO :0004252 : serine-type endopeptidase activity and also this GO :0005515 : protein binding and also this GO :0008233 : peptidase activity and also this GO :0008236 : serine-type peptidase activity and also this GO :0051082 : unfolded protein binding, this GO :0004252 : serine-type endopeptidase activity, this GO :0005515 : protein binding, this GO :0008233 : peptidase activity, this GO :0008236 : serine-type peptidase activity, this GO :0051082 : unfolded protein binding, unfolded protein binding, HtrA serine peptidase 2
Identity: 14348
Gene: HTRA2 | More about : HTRA2
Long gene name: HtrA serine peptidase 2
Synonyms gene: PRSS25
Synonyms gene name: 25 , protease, serine
Synonyms: OMI PARK13
Locus: 2p13, 1
Discovery year: 2001-09-26
Entrez gene record: 27429
Pubmed identfication: 10644717 10971580
RefSeq identity: NM_013247
Classification: Parkinson disease associated genes Proteases, serine PDZ domain containing
Havana BLAST/BLAT: OTTHUMG00000129957

Related Products :

C760 Recombinant Human Serine Protease HTRA2, HTRA2, Omi (C-6His) 1 mg 1115 € novo human
GWB-P0152I HtrA2/Omi 134-458 Human, Recombinant, His- tagged, E.coli bulk Ask price € genways bulk human
RP-0809H Recombinant Human HTRA2 / OMI Protein (His Tag) 100μg 624 € adv human
GENTAUR-58ba0ef957a71 Drosophila erecta Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 1945 € MBS Recombinant Proteins drosophila
GENTAUR-58ba0efa4ffd5 Drosophila erecta Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 2453 € MBS Recombinant Proteins drosophila
GENTAUR-58ba0f67ae98b Drosophila erecta Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 1945 € MBS Recombinant Proteins drosophila
GENTAUR-58ba0f688dd26 Drosophila erecta Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 2453 € MBS Recombinant Proteins drosophila
GENTAUR-58ba44394b07f Drosophila grimshawi Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 1945 € MBS Recombinant Proteins drosophila
GENTAUR-58ba443a2509c Drosophila grimshawi Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 2453 € MBS Recombinant Proteins drosophila
GENTAUR-58b8c51876def Drosophila mojavensis Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 1945 € MBS Recombinant Proteins drosophila
GENTAUR-58b8c518db7d1 Drosophila mojavensis Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 2453 € MBS Recombinant Proteins drosophila
GENTAUR-58b9c5dcb122e Drosophila mojavensis Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 1945 € MBS Recombinant Proteins drosophila
GENTAUR-58b9c5dd0a521 Drosophila mojavensis Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 2453 € MBS Recombinant Proteins drosophila
GENTAUR-58b9cb60bacbd Drosophila persimilis Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 1951 € MBS Recombinant Proteins drosophila
GENTAUR-58b9cb6136aea Drosophila persimilis Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 2453 € MBS Recombinant Proteins drosophila
GENTAUR-58b9bb7a740fc Drosophila sechellia Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 1945 € MBS Recombinant Proteins drosophila
GENTAUR-58b9bb7ad4d08 Drosophila sechellia Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 2453 € MBS Recombinant Proteins drosophila
GENTAUR-58ba694419db2 Drosophila virilis Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 1945 € MBS Recombinant Proteins drosophila
GENTAUR-58ba69452aa50 Drosophila virilis Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 2453 € MBS Recombinant Proteins drosophila
GENTAUR-58b88218997f9 Drosophila willistoni Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 1951 € MBS Recombinant Proteins drosophila
GENTAUR-58b882191ddec Drosophila willistoni Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 2453 € MBS Recombinant Proteins drosophila
GENTAUR-58ba3c3d3cb61 Drosophila yakuba Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 1945 € MBS Recombinant Proteins drosophila
GENTAUR-58ba3c3e3ceae Drosophila yakuba Serine protease HTRA2, mitochondrial (HtrA2) 1000ug 2453 € MBS Recombinant Proteins drosophila
MBS240350 Anti-Human HTRA2 / OMI 50ug 597 € MBS Polyclonals_1 human
MBS241274 Anti-Human HTRA2 / OMI Antibody 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58be5ccd66815 Anti-HtrA2/Omi (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
GWB-5D203F HtrA2/Omi bulk Ask price € genways bulk human
bs-1271R-A350 HtrA2/Omi Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1271R-A488 HtrA2/Omi Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1271R-A555 HtrA2/Omi Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human