| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human HTRA2 is produced by our Mammalian expression system and the target gene encoding Ala134-Glu458 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
36 kD |
| UniProt number: |
O43464 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, 5, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
AVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTEVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
HTRA2, Omi (C-6His), Serine Protease HTRA2 |
| Short name: |
HTRA2, Omi (C-6His), Recombinant Serine Protease HTRA2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
HtrA serine peptidase 2, Omi (C-6His), sapiens Serine Protease HtrA serine peptidase 2, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
HTRA2 and IDBG-57753 and ENSG00000115317 and 27429, HTRA2 and IDBG-631258 and ENSBTAG00000020124 and 523039, Htra2 and IDBG-159586 and ENSMUSG00000068329 and 64704, nuclei, this GO :0000785 and chromatin and cellular component this GO :0003824 and catalytic activity and molecular function this GO :0004252 and serine-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005758 and mitochondrial intermembrane space and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0005829 and cytosol and cellular component this GO :0005856 and cytoskeleton and cellular component this GO :0006508 and proteolysis and biological process this GO :0006672 and ceramide metabolic process and biological process this GO :0007005 and mitochondrion organization and biological process this GO :0007628 and adult walking behavior and biological process this GO :0008233 and peptidase activity and molecular function this GO :0008236 and serine-type peptidase activity and molecular function this GO :0008344 and adult locomotory behavior and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0009635 and response to herbicide and biological process this GO :0009898 and cytoplasmic side of plasma membrane and cellular component this GO :0010942 and positive regulation of cell death and biological process this GO :0016020 and membrane and cellular component this GO :0016540 and protein autoprocessing and biological process this GO :0019742 and pentacyclic triterpenoid metabolic process and biological process this GO :0030900 and forebrain development and biological process this GO :0031966 and mitochondrial membrane and cellular component this GO :0034605 and cellular response to heat and biological process this GO :0035631 and CD40 receptor complex and cellular component this GO :0040014 and regulation of multicellular organism growth and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043280 and positive regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0045786 and negative regulation of cell cycle and biological process this GO :0048666 and neuron development and biological process this GO :0051082 and unfolded protein binding and molecular function this GO :0060548 and negative regulation of cell death and biological process this GO :0071363 and cellular response to growth factor stimulus and biological process this GO :0097193 and intrinsic apoptotic signaling pathway and biological process this GO :0097194 and execution phase of apoptosis and biological process this GO :2001241 and positive regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process this GO :2001269 and positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway and biological process, this GO :0003824 : catalytic activity, this GO :0003824 : catalytic activity and also this GO :0004252 : serine-type endopeptidase activity and also this GO :0005515 : protein binding and also this GO :0008233 : peptidase activity and also this GO :0008236 : serine-type peptidase activity and also this GO :0051082 : unfolded protein binding, this GO :0004252 : serine-type endopeptidase activity, this GO :0005515 : protein binding, this GO :0008233 : peptidase activity, this GO :0008236 : serine-type peptidase activity, this GO :0051082 : unfolded protein binding, unfolded protein binding, HtrA serine peptidase 2 |
| Identity: |
14348 |
| Gene: |
HTRA2 |
More about : HTRA2 |
| Long gene name: |
HtrA serine peptidase 2 |
| Synonyms gene: |
PRSS25 |
| Synonyms gene name: |
25 , protease, serine |
| Synonyms: |
OMI PARK13 |
| Locus: |
2p13, 1 |
| Discovery year: |
2001-09-26 |
| Entrez gene record: |
27429 |
| Pubmed identfication: |
10644717 10971580 |
| RefSeq identity: |
NM_013247 |
| Classification: |
Parkinson disease associated genes Proteases, serine PDZ domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000129957 |