Recombinant Human VEGF-A, VEGF121

Contact us
Catalog number: C744
Price: 541 €
Supplier: Biomatik ELISA kits
Product name: Recombinant Human VEGF-A, VEGF121
Quantity: 1 plate of 96 wells
Other quantities: 1 mg 2486€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Vascular Endothelial Growth Factor A is produced by our E, coli expression system and the target gene encoding Ala27-Arg147 is expressed
Molecular Weight: 14, 2 kD
UniProt number: P15692
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: VEGF121, VEGF-A
Short name: VEGF121, Recombinant VEGF-A
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: VEGF121, sapiens VEGF-A, recombinant H
Alternative technique: rec
Identity: 12680
Gene: VEGFA | More about : VEGFA
Long gene name: vascular endothelial growth factor A
Synonyms gene: VEGF
Synonyms gene name: vascular endothelial growth factor
Synonyms: VEGF-A VPF
Locus: 6p21, 1
Discovery year: 1994-01-10
GenBank acession: AB021221
Entrez gene record: 7422
Pubmed identfication: 8786112
RefSeq identity: NM_001025366
Classification: VEGF family
Havana BLAST/BLAT: OTTHUMG00000014745
Locus Specific Databases: ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database

Related Products :

C744 Recombinant Human VEGF-A, VEGF121 10 µg 202 € novo human
C699 Recombinant Human VEGF-A, VEGF121 (C-6His) 50 µg 496 € novo human
RP-1624H Recombinant Human VEGF121 / VEGF-A Protein 20μg 456 € adv human
VEGF28-R-10 Human Recombinant VEGF121 Protein (E. coli, his-tag) 10 μg 521 € adi e-coli
VEGF25-R-10 Human Recombinant VEGF121 Protein (E.Coli), biologically active 10 μg 521 € adi human
VEGF25-R-100 Human Recombinant VEGF121 Protein (E.Coli), biologically active 100 μg 2878 € adi human
VEGF24-R-10 Human Recombinant VEGF121 Protein (Sf9), biologically active 10 μg 521 € adi human
VEGF24-R-100 Human Recombinant VEGF121 Protein (Sf9), biologically active 100 μg 2878 € adi human
GWB-BIG143 Recombinant Human VEGF121 bulk Ask price € genways bulk human
CJ93 Recombinant Human VEGF Receptor 1, VEGF R1, FLT-1 (C-Fc) 500 µg 1115 € novo human
CJ92 Recombinant Human VEGF Receptor 2, VEGF R2, FLK-1, KDR (C-Fc) 500 µg 1115 € novo human
GWB-P0011K VEGF121, 207-327aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-P1755M VEGF121, 207-327aa, Recombinant Protein bulk Ask price € genways bulk human
ZR-40-163 VEGF121 Recombinant Protein 0.002 mg 256 € Zyagen human
abx153464 Anti-Human VEGF121 ELISA Kit inquire 50 € abbex human
abx574587 Anti-Human VEGF121 ELISA Kit inquire 50 € abbex human
AE11723HU-48 ELISA test for Human Vascular Endothelial Growth Factor 121 (VEGF121) 1x plate of 48 wells 402 € abebio human
AE11723HU Human Vascular Endothelial Growth Factor 121 (VEGF121) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE11723HU-96 Human Vascular Endothelial Growth Factor 121 (VEGF121) ELISA Kit 1x plate of 96 wells 671 € abebio human
DL-VEGF121-Hu Human Vascular Endothelial Growth Factor 121 VEGF121 ELISA Kit 96T 568 € DL elisas human
MBS551131 Human VEGF121 Affinity Purified Polyclonal Antibody 50ug 337 € MBS Polyclonals_1 human
OBT1752 Vascular Endothelial Growth Factor (VEGF165 & VEGF121), Clone: 26503, Mouse Monoclonal antibody-Human; IH/ELISA/WB/Neutralizes 0.5mg Ask price € accurate-monoclonals human
DEVAS1721 Vascular Endothelial Growth Factor (VEGF), Clone: mxsghk-VEGF, Mouse Monoclonal antibody-Human; ELISA 200ug 448 € accurate-monoclonals human
abx155122 Anti-Rabbit VEGF121 ELISA Kit 96 tests 949 € abbex human
abx574888 Anti-Rabbit VEGF121 ELISA Kit inquire 50 € abbex human
abx156220 Anti-Rat VEGF121 ELISA Kit inquire 50 € abbex rat
abx574848 Anti-Rat VEGF121 ELISA Kit 96 tests 644 € abbex rat
DL-VEGF121-Rb Rabbit Vascular Endothelial Growth Factor 121 VEGF121 ELISA Kit 96T 846 € DL elisas human
DL-VEGF121-Ra Rat Vascular Endothelial Growth Factor 121 VEGF121 ELISA Kit 96T 730 € DL elisas rat
EKU08082 Vascular Endothelial Growth Factor 121 (VEGF121) ELISA kit 1 plate of 96 wells 541 € Biomatik ELISA kits human