Recombinant Human S100 Calcium Binding Protein A12, S100A12

Contact us
Catalog number: C743
Price: 520 €
Supplier: MBS Polyclonals
Product name: Recombinant Human S100 Calcium Binding Protein A12, S100A12
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 146€ 50 µg 303€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human S100 calcium-binding protein A12 is produced by our E, coli expression system and the target gene encoding Met1-Glu92 is expressed
Molecular Weight: 10, 6 kD
UniProt number: P80511
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: S100A12, S100 Calcium Binding Protein A12
Short name: S100A12, Recombinant S100 Calcium Binding Protein A12
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: S100A12, sapiens S100 Calcium Binding Protein A12, recombinant H
Alternative technique: rec
Identity: 10489
Gene: S100A12 | More about : S100A12
Long gene name: S100 calcium binding protein A12
Synonyms gene name: S100 calcium-binding protein A12 (calgranulin C) S100 calcium binding protein A12 (calgranulin C)
Synonyms: p6 MRP6 CGRP CAAF1 CAGC ENRAGE
Locus: 1q21, 3
Discovery year: 1997-10-30
GenBank acession: BC070294
Entrez gene record: 6283
Pubmed identfication: 8985590
RefSeq identity: NM_005621
Classification: S100 calcium binding proteins EF-hand domain containing
Havana BLAST/BLAT: OTTHUMG00000013127

Related Products :

MBS623290 S100 Calcium Binding Protein A12 (S100A12, CAAF1, Calcium-binding Protein in Amniotic Fluid, Calgranulin-C, CAGC, Calgranulin Related Protein, CGRP, EN-RAGE, ENRAGE, Extracellular Newly Identified RAGE-binding Protein, Neutrophil S100 Protein, p6) 100ul 597 € MBS Polyclonals_1 human
C743 Recombinant Human S100 Calcium Binding Protein A12, S100A12 500 µg 1613 € novo human
AE20927HU-48 ELISA test for Human S100 calcium binding protein A12/Calgranulin-C (S100A12) 1x plate of 48 wells 402 € abebio human
AE20927HU Human S100 calcium binding protein A12/Calgranulin-C (S100A12) ELISA Kit 48 wells plate 525 € ab-elisa elisas human
AE20927HU-96 Human S100 calcium binding protein A12/Calgranulin-C (S100A12) ELISA Kit 1x plate of 96 wells 671 € abebio human
DL-S100A12-Hu Human S100 Calcium Binding Protein A12 S100A12 ELISA Kit 96T 788 € DL elisas human
GENTAUR-58bdc6fa4f2d0 Anti- S100 Calcium Binding Protein A12 (S100A12) Antibody 50ug 332 € MBS Polyclonals human
GENTAUR-58bdc6fabc288 Anti- S100 Calcium Binding Protein A12 (S100A12) Antibody 100ug 409 € MBS Polyclonals human
GENTAUR-58bdcd5fc8846 Anti- S100 Calcium Binding Protein A12 (S100A12) Antibody 100ug 442 € MBS Polyclonals human
GENTAUR-58bdd5e7cf614 Anti- S100 Calcium Binding Protein A12 (S100A12) Antibody 100ug 475 € MBS Polyclonals human
EKU07164 S100 Calcium Binding Protein A12 (S100A12) ELISA kit 1 plate of 96 wells 667 € Biomatik ELISA kits human
MBS613298 CABP9K (CALB3, CABP1, S100G, S100 calcium binding protein G, CABP, Calbindin-D9k, MGC138379, Protein S100-G, S100 calcium-binding protein G, S100D, Vitamin D-dependent calcium-binding protein, intestinal) Antibody 0.05 ml 442 € MBS Polyclonals_1 human
GENTAUR-58baf45cc0560 Rabbit Protein S100-A12 (S100A12) 100ug 1343 € MBS Recombinant Proteins human
GENTAUR-58baf45d1d8fc Rabbit Protein S100-A12 (S100A12) 1000ug 1343 € MBS Recombinant Proteins human
GENTAUR-58baf45d79ba9 Rabbit Protein S100-A12 (S100A12) 100ug 1846 € MBS Recombinant Proteins human
GENTAUR-58baf45df0022 Rabbit Protein S100-A12 (S100A12) 1000ug 1846 € MBS Recombinant Proteins human
GENTAUR-58bb202d35ab8 Rabbit Protein S100-A12 (S100A12) 100ug 1343 € MBS Recombinant Proteins human
GENTAUR-58bb202d833c5 Rabbit Protein S100-A12 (S100A12) 1000ug 1343 € MBS Recombinant Proteins human
GENTAUR-58bb202dbe7b4 Rabbit Protein S100-A12 (S100A12) 100ug 1846 € MBS Recombinant Proteins human
GENTAUR-58bb202e12f33 Rabbit Protein S100-A12 (S100A12) 1000ug 1846 € MBS Recombinant Proteins human
abx262635 Anti-S100 Calcium Binding Protein A12 Protein (Recombinant) 2 µg 238 € abbex human
C258 Recombinant Human S100 Calcium Binding Protein P, S100-P (N-6His) 50 µg 496 € novo human
MBS280005 Anti-Human S100 Calcium Binding Protein (S100) PAb 100ug 520 € MBS Polyclonals_1 human
DL-S100-Hu Human S100 Calcium Binding Protein S100 ELISA Kit 96T 846 € DL elisas human
MBS619446 ORAI1 (ORAI Calcium Release-Activated Calcium Modulator 1, CRACM1, FLJ14466, ORAT1, TMEM142A, calcium release-activated calcium channel protein 1, Transmembrane protein 142A) Antibody 100ug 591 € MBS Polyclonals_1 human
abx576375 Anti-Cow S100 Calcium Binding Protein (S100) ELISA Kit 96 tests 833 € abbex cow
abx573893 Anti-Rat S100 Calcium Binding Protein (S100) ELISA Kit inquire 50 € abbex rat
GENTAUR-58bdc70c34539 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdc70c87593 Anti- S100 Calcium Binding Protein (S100) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdc89941793 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 520 € MBS Polyclonals human