| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Tumor Necrosis Factor Receptor I is produced by our E, coli expression system and the target gene encoding Ile22-Thr211 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
23, 5 kD |
| UniProt number: |
P19438 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD120a (N-6His), TNFRSF1A, Tumor Necrosis Factor Receptor I |
| Short name: |
CD120a (N-6His), TNFRSF1A, Recombinant Tumor Necrosis Factor Receptor I |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD120a (N-6His), member 1A, sapiens Tumor Necrosis Factor Receptor I, tumor necrosis factor receptor superfamily, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD120a and FPF and MS5 and p55 and p55-R and p60 and TBP1 and TNF-R and TNF-R-I and TNF-R55 and TNFAR and TNFR1 and TNFR1-d2 and TNFR55 and TNFR60, TNFRSF1A and IDBG-13807 and ENSG00000067182 and 7132, TNFRSF1A and IDBG-640513 and ENSBTAG00000004211 and 282527, Tnfrsf1a and IDBG-189844 and ENSMUSG00000030341 and 21937, member 1A, nuclei, this GO :0000139 and this GO lgi membrane and cellular component this GO :0001666 and response to hypoxia and biological process this GO :0002020 and protease binding and molecular function this GO :0005031 and tumor necrosis factor-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006693 and prostaglandin metabolic process and biological process this GO :0006915 and apoptotic process and biological process this GO :0006952 and defense response and biological process this GO :0006954 and inflammatory response and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0008625 and extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0009611 and response to wounding and biological process this GO :0009986 and cell surface and cellular component this GO :0010628 and positive regulation of gene expression and biological process this GO :0010629 and negative regulation of gene expression and biological process this GO :0016032 and viral process and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030424 and axon and cellular component this GO :0032403 and protein complex binding and molecular function this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032715 and negative regulation of interleukin-6 production and biological process this GO :0032760 and positive regulation of tumor necrosis factor production and biological process this GO :0033013 and tetrapyrrole metabolic process and biological process this GO :0033160 and positive regulation of protein import into nucleus, this GO :0002020 : protease binding, this GO :0002020 : protease binding and also this GO :0005031 : tumor necrosis factor-activated receptor activity and also this GO :0005515 : protein binding and also this GO :0032403 : protein complex binding and also this GO :0043120 : tumor necrosis factor binding, this GO :0005031 : tumor necrosis factor-activated receptor activity, this GO :0005515 : protein binding, this GO :0032403 : protein complex binding, this GO :0043120 : tumor necrosis factor binding, translocation and biological process this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0042511 and positive regulation of tyrosine phosphorylation of Stat1 protein and biological process this GO :0042742 and defense response to bacterium and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043120 and tumor necrosis factor binding and molecular function this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043200 and response to amino acid and biological process this GO :0043234 and protein complex and cellular component this GO :0043235 and receptor complex and cellular component this GO :0043279 and response to alkaloid and biological process this GO :0043525 and positive regulation of neuron apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045121 and membrane raft and cellular component this GO :0045202 and synapse and cellular component this GO :0045471 and response to ethanol and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0050728 and negative regulation of inflammatory response and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0051291 and protein heterooli this GO merization and biological process this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :0071392 and cellular response to estradiol stimulus and biological process this GO :0097190 and apoptotic signaling pathway and biological process, tumor necrosis factor binding, tumor necrosis factor receptor superfamily |
| Identity: |
11916 |
| Gene: |
TNFRSF1A |
More about : TNFRSF1A |
| Long gene name: |
TNF receptor superfamily member 1A |
| Synonyms gene: |
TNFR1 |
| Synonyms gene name: |
member 1A , tumor necrosis factor receptor superfamily |
| Synonyms: |
TNF-R TNFAR TNFR60 TNF-R-I CD120a TNF-R55 |
| Locus: |
12p13, 31 |
| Discovery year: |
1991-01-15 |
| GenBank acession: |
M75866 |
| Entrez gene record: |
7132 |
| Pubmed identfication: |
1655358 2158863 |
| RefSeq identity: |
NM_001065 |
| Classification: |
CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000168267 |
| Locus Specific Databases: |
INFEVERS: The repertory of Familial Mediterranean Fever (FMF) and Hereditary Inflammatory Disorders Mutations LRG_193 |