Recombinant Human Glucagon, GCG (C-6His)

Catalog number:	C664 Buy Now
Price:	1790 €
Supplier:	MBS Recombinant Proteins
Product name:	Recombinant Human Glucagon, GCG (C-6His)
Quantity:	1000ug
Other quantities:	10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:	human glucagon gcg sapiens glp peptide source

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Glucagon is produced by our Mammalian expression system and the target gene encoding Arg21-Lys180 is expressed with a 6His tag at the C-terminus
Molecular Weight:	18, 6 kD
UniProt number:	P01275
State of the product:	Liquid
Shipping conditions:	Dry ice/ice packs
Formulation:	1 mM DTT, 2 um filtered solution of 20 mM TrisHCl, 200 mM sodium chloride, 50% Glycerol, Supplied as a 0, pH 8
Storage recommendations:	-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution:	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	GCG (C-6His), Glucagon
Short name:	GCG (C-6His), Recombinant Glucagon
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	GCG (C-6His), sapiens Glucagon, recombinant H
Alternative technique:	rec
Identity:	4191
Gene:	GCG | More about : GCG
Long gene name:	glucagon
Synonyms:	GLP1 GLP2 GRPP GLP-1
Synonyms name:	glicentin-related polypeptide glucagon-like peptide 1 glucagon-like peptide 2 preproglucagon
Locus:	2q24, 2
Discovery year:	2001-06-22
Entrez gene record:	2641
Pubmed identfication:	2753890 3725587
RefSeq identity:	NM_002054
Classification:	Endogenous ligands
Havana BLAST/BLAT:	OTTHUMG00000153892

• #human
• #glucagon
• #gcg
• #sapiens
• #glp
• #peptide
• #source