| Catalog number: | C644 |
|---|---|
| Price: | 1547 € |
| Supplier: | MBS Recombinant Proteins |
| Product name: | Recombinant Human HAI-2, KOP, SPINT2 (C-6His) |
| Quantity: | 100ug |
| Other quantities: | 10 µg 156€ 50 µg 369€ 500 µg 1613€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human Hepatocyte Growth Factor Activator Inhibitor Type 2 is produced by our Mammalian expression system and the target gene encoding Ala28-Lys197 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: | 20, 22 kD |
| UniProt number: | O43291 |
| State of the product: | Freeze-dried |
| Shipping conditions: | Ambient temperature |
| Formulation: | 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSKVDHHHHHH |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | KOP, SPINT2 (C-6His), HAI-2 |
| Short name: | KOP, SPINT2 (C-6His), Recombinant HAI-2 |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | KOP, SPINT2 (C-6His), sapiens HAI-2, recombinant H |
| Alternative technique: | rec |
| Identity: | 11247 |
| Gene: | SPINT2 | More about : SPINT2 |
| Long gene name: | Kunitz type 2 , serine peptidase inhibitor |
| Synonyms gene name: | 2 , Kunitz type, serine protease inhibitor |
| Synonyms: | Kop HAI-2 |
| Synonyms name: | placental bikunin |
| Locus: | 19q13, 2 |
| Discovery year: | 1999-07-23 |
| GenBank acession: | U78095 |
| Entrez gene record: | 10653 |
| Pubmed identfication: | 9115294 9346890 |
| Havana BLAST/BLAT: | OTTHUMG00000181891 |
| C644 | Recombinant Human HAI-2, KOP, SPINT2 (C-6His) | 10 µg | 156 € | novo | human |
| RP-1320M | Recombinant Mouse HAI-2 / SPINT2 Protein (His Tag) | 10μg | 624 € | adv | mouse |
| MBS248857 | Goat Polyclonal to Human SPINT2 / HAI-2 Antibody | 50ug | 597 € | MBS Polyclonals_1 | human |
| RP-1672H | Recombinant Human HAI-1 / SPINT1 Protein (His Tag) | 10μg | 624 € | adv | human |
| GWB-ATG073 | SPINT2, 28-197aa, Human, His tag, E.coli, Recombinant Protein | bulk | Ask price € | genways bulk | human |
| 101-M445 | Anti-Human HAI-1 | 100ug | 336 € | Reliatech antibodies | human |
| 101-M446 | Anti-Human HAI-2 | 100ug | 336 € | Reliatech antibodies | human |
| abx142242 | Anti-HAI-1 Antibody | 200 μl | 514 € | abbex | human |
| GENTAUR-58be59aad42ec | Anti-HAI-1 (Polyclonal), ALEXA Fluor 594 | 100 microliters | 489 € | Bioss Polyclonal Antibodies | human |
| abx142243 | Anti-HAI-2 Antibody | 50 μl | 325 € | abbex | human |
| 103-M229 | Anti-Mouse HGF Activator Inhibitor Type 1 (HAI-1) | 100ug | 336 € | Reliatech antibodies | mouse |
| 103-M230 | Anti-Mouse HGF Activator Inhibitor Type 2 (HAI-2) | 100ug | 336 € | Reliatech antibodies | mouse |
| bs-0540R-A350 | HAI-1 Antibody, ALEXA FLUOR 350 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-0540R-A488 | HAI-1 Antibody, ALEXA FLUOR 488 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-0540R-A555 | HAI-1 Antibody, ALEXA FLUOR 555 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-0540R-A594 | HAI-1 Antibody, ALEXA FLUOR 594 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-0540R-A647 | HAI-1 Antibody, ALEXA FLUOR 647 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-0540R-Biotin | HAI-1 Antibody, Biotin Conjugated | 0.1ml | 333 € | Bioss Primary Conjugated Antibodies | human |
| bs-0540R | HAI-1 Antibody | 0.1ml | 263 € | Bioss Primary Unconjugated Antibodies | human |
| bs-0540R-Cy3 | HAI-1 Antibody, Cy3 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-0540R-Cy5 | HAI-1 Antibody, Cy5 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-0540R-Cy5.5 | HAI-1 Antibody, Cy5.5 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-0540R-Cy7 | HAI-1 Antibody, Cy7 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-0540R-FITC | HAI-1 Antibody, FITC Conjugated | 0.1ml | 333 € | Bioss Primary Conjugated Antibodies | human |
| bs-0540R-HRP | HAI-1 Antibody, HRP Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| MBS610374 | Matriptase (ST14, SNC19, SNC-19, Epitin, Prostamin, TADG-15, MT-SP1, MTSP1, PRSS14, HAI) Antibody | 100ug | 774 € | MBS Polyclonals_1 | human |
| MBS611938 | Matriptase (ST14, SNC19, SNC-19, Epitin, Prostamin, TADG-15, MT-SP1, MTSP1, PRSS14, HAI) Antibody | 100ul | 680 € | MBS Polyclonals_1 | human |
| abx153155 | Anti-Human SPINT2 ELISA Kit | inquire | 50 € | abbex | human |
| abx572573 | Anti-Human SPINT2 ELISA Kit | 96 tests | 789 € | abbex | human |
| GENTAUR-58b99cf1999d4 | Human Kunitz-type protease inhibitor 2 (SPINT2) | 100ug | 1547 € | MBS Recombinant Proteins | human |