Recombinant Human HAI-2, KOP, SPINT2 (C-6His)

Catalog number:	C644 Buy Now
Price:	1547 €
Supplier:	MBS Recombinant Proteins
Product name:	Recombinant Human HAI-2, KOP, SPINT2 (C-6His)
Quantity:	100ug
Other quantities:	1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:	human gene spint hai synonyms homo

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Hepatocyte Growth Factor Activator Inhibitor Type 2 is produced by our Mammalian expression system and the target gene encoding Ala28-Lys197 is expressed with a 6His tag at the C-terminus
Molecular Weight:	20, 22 kD
UniProt number:	O43291
State of the product:	Freeze-dried
Shipping conditions:	Ambient temperature
Formulation:	150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations:	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution:	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSKVDHHHHHH
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	KOP, SPINT2 (C-6His), HAI-2
Short name:	KOP, SPINT2 (C-6His), Recombinant HAI-2
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	KOP, SPINT2 (C-6His), sapiens HAI-2, recombinant H
Alternative technique:	rec
Identity:	11247
Gene:	SPINT2 | More about : SPINT2
Long gene name:	Kunitz type 2 , serine peptidase inhibitor
Synonyms gene name:	2 , Kunitz type, serine protease inhibitor
Synonyms:	Kop HAI-2
Synonyms name:	placental bikunin
Locus:	19q13, 2
Discovery year:	1999-07-23
GenBank acession:	U78095
Entrez gene record:	10653
Pubmed identfication:	9115294 9346890
Havana BLAST/BLAT:	OTTHUMG00000181891

• #human
• #gene
• #spint
• #hai
• #synonyms
• #homo