Recombinant Human HAI-2, KOP, SPINT2 (C-6His)

Contact us
Catalog number: C644
Price: 1547 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human HAI-2, KOP, SPINT2 (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Hepatocyte Growth Factor Activator Inhibitor Type 2 is produced by our Mammalian expression system and the target gene encoding Ala28-Lys197 is expressed with a 6His tag at the C-terminus
Molecular Weight: 20, 22 kD
UniProt number: O43291
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSKVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: KOP, SPINT2 (C-6His), HAI-2
Short name: KOP, SPINT2 (C-6His), Recombinant HAI-2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: KOP, SPINT2 (C-6His), sapiens HAI-2, recombinant H
Alternative technique: rec
Identity: 11247
Gene: SPINT2 | More about : SPINT2
Long gene name: Kunitz type 2 , serine peptidase inhibitor
Synonyms gene name: 2 , Kunitz type, serine protease inhibitor
Synonyms: Kop HAI-2
Synonyms name: placental bikunin
Locus: 19q13, 2
Discovery year: 1999-07-23
GenBank acession: U78095
Entrez gene record: 10653
Pubmed identfication: 9115294 9346890
Havana BLAST/BLAT: OTTHUMG00000181891

Related Products :

C644 Recombinant Human HAI-2, KOP, SPINT2 (C-6His) 10 µg 156 € novo human
RP-1320M Recombinant Mouse HAI-2 / SPINT2 Protein (His Tag) 10μg 624 € adv mouse
MBS248857 Goat Polyclonal to Human SPINT2 / HAI-2 Antibody 50ug 597 € MBS Polyclonals_1 human
RP-1672H Recombinant Human HAI-1 / SPINT1 Protein (His Tag) 10μg 624 € adv human
GWB-ATG073 SPINT2, 28-197aa, Human, His tag, E.coli, Recombinant Protein bulk Ask price € genways bulk human
101-M445 Anti-Human HAI-1 100ug 336 € Reliatech antibodies human
101-M446 Anti-Human HAI-2 100ug 336 € Reliatech antibodies human
abx142242 Anti-HAI-1 Antibody 200 μl 514 € abbex human
GENTAUR-58be59aad42ec Anti-HAI-1 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx142243 Anti-HAI-2 Antibody 50 μl 325 € abbex human
103-M229 Anti-Mouse HGF Activator Inhibitor Type 1 (HAI-1) 100ug 336 € Reliatech antibodies mouse
103-M230 Anti-Mouse HGF Activator Inhibitor Type 2 (HAI-2) 100ug 336 € Reliatech antibodies mouse
bs-0540R-A350 HAI-1 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-0540R-A488 HAI-1 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-0540R-A555 HAI-1 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-0540R-A594 HAI-1 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-0540R-A647 HAI-1 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-0540R-Biotin HAI-1 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-0540R HAI-1 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-0540R-Cy3 HAI-1 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-0540R-Cy5 HAI-1 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-0540R-Cy5.5 HAI-1 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-0540R-Cy7 HAI-1 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-0540R-FITC HAI-1 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-0540R-HRP HAI-1 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
MBS610374 Matriptase (ST14, SNC19, SNC-19, Epitin, Prostamin, TADG-15, MT-SP1, MTSP1, PRSS14, HAI) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS611938 Matriptase (ST14, SNC19, SNC-19, Epitin, Prostamin, TADG-15, MT-SP1, MTSP1, PRSS14, HAI) Antibody 100ul 680 € MBS Polyclonals_1 human
abx153155 Anti-Human SPINT2 ELISA Kit inquire 50 € abbex human
abx572573 Anti-Human SPINT2 ELISA Kit 96 tests 789 € abbex human
GENTAUR-58b99cf1999d4 Human Kunitz-type protease inhibitor 2 (SPINT2) 100ug 1547 € MBS Recombinant Proteins human