Recombinant Human Syndecan-2, SDC2, CD362 (C-6His)

Contact us
Catalog number: C635
Price: 354 €
Supplier: abbex
Product name: Recombinant Human Syndecan-2, SDC2, CD362 (C-6His)
Quantity: 10 μg
Other quantities: 1 mg 2283€ 10 µg 131€ 50 µg 273€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Syndecan-2 is produced by our Mammalian expression system and the target gene encoding Glu19-Glu144 is expressed with a 6His tag at the C-terminus
Molecular Weight: 14, 98 kD
UniProt number: P34741
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM Tris-Citrate, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD362 (C-6His), SDC2, Syndecan-2
Short name: CD362 (C-6His), SDC2, Recombinant Syndecan-2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD362 (C-6His), SDC2, sapiens Syndecan-2, recombinant H
Alternative technique: rec
Identity: 10659
Gene: SDC2 | More about : SDC2
Long gene name: syndecan 2
Synonyms gene: HSPG HSPG1
Synonyms gene name: cell surface-associated , heparan sulfate proteoglycan 1
Synonyms: fibroglycan SYND2 CD362
Synonyms name: syndecan proteoglycan 2
Locus: 8q22, 1
Discovery year: 1989-06-30
GenBank acession: BC030133
Entrez gene record: 6383
Pubmed identfication: 8187643
RefSeq identity: NM_002998
Classification: CD molecules Syndecans
Havana BLAST/BLAT: OTTHUMG00000164689

Related Products :

C635 Recombinant Human Syndecan-2, SDC2, CD362 (C-6His) 50 µg 273 € novo human
MBS248640 PAb (IgG) to Human SDC2 / Syndecan 2 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58bd110538fd5 Xenopus laevis Syndecan-2-A (sdc2-a) 100ug 1404 € MBS Recombinant Proteins xenopus
GENTAUR-58bd11059aa8e Xenopus laevis Syndecan-2-A (sdc2-a) 1000ug 1404 € MBS Recombinant Proteins xenopus
GENTAUR-58bd110607aa9 Xenopus laevis Syndecan-2-A (sdc2-a) 100ug 1912 € MBS Recombinant Proteins xenopus
GENTAUR-58bd1106623e8 Xenopus laevis Syndecan-2-A (sdc2-a) 1000ug 1912 € MBS Recombinant Proteins xenopus
CA71 Recombinant Human Syndecan-1, SDC1, CD138 (C-6His) 500 µg 1613 € novo human
CJ11 Recombinant Mouse Syndecan-4, SDC4 (C-6His) 10 µg 100 € novo mouse
C776 Recombinant Mouse Syndecan-Binding Protein 1, Syntenin-1, SDCBP (C-6His) 10 µg 202 € novo mouse
LV298376 SDC2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
A01S0026 anti-SDC2 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58bdea71f09b3 Anti- SDC2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdea7255ca7 Anti- SDC2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be3d09ee053 Anti- SDC2 Antibody 100ug 393 € MBS Polyclonals human
abx216081 Anti-SDC2 Antibody 100 μg 311 € abbex human
abx904822 Anti-SDC2 siRNA 15 nmol 528 € abbex human
abx932692 Anti-SDC2 siRNA inquire 50 € abbex human
abx932693 Anti-SDC2 siRNA inquire 50 € abbex human
MBS127133 SDC2 Polyclonal Antibody 100ug 387 € MBS Polyclonals_1 human
RP-993 Recombinant (E.Coli, His-tag) Human Syndecan-4, His-tag 10 μg 260 € adi human
RP-1376H Recombinant Human Syndecan-1 / SDC1 / CD138 Protein (His Tag) 50μg 624 € adv human
GWB-5A06E6 Recombinant Human Syndecan-4 bulk Ask price € genways bulk human
abx263542 Anti-Syndecan-1, GST tag Protein (Recombinant) 5 µg 557 € abbex human
abx167325 Anti-Syndecan 1 Protein (Recombinant) 50 μg 615 € abbex human
abx168001 Anti-Syndecan 1 Protein (Recombinant) 100 μg 833 € abbex human
abx168119 Anti-Syndecan 1 Protein (Recombinant) 100 μg 833 € abbex human
abx260877 Anti-Syndecan-1 Protein (Recombinant) 20 µg 340 € abbex human
abx260453 Anti-Syndecan-4, His Tag Protein (Recombinant) 50 µg 340 € abbex human
abx166365 Anti-Syndecan 4 Protein (Recombinant) 100 μg 847 € abbex human
abx166419 Anti-Syndecan 4 Protein (Recombinant) 10 μg 354 € abbex human