| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human FcRL1 is produced by our Mammalian expression system and the target gene encoding Ala17-Asn303 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
24 kD, 32 |
| UniProt number: |
Q96LA6 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
1 mM EDTA, 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
AELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGARSNVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD307a (C-6His), FCRL1, Fc Receptor-Like Protein 1 |
| Short name: |
CD307a (C-6His), FCRL1, Recombinant Fc Receptor-Like Protein 1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD307a (C-6His), fragment c receptor-like 1, sapiens fragment c Receptor-Like Protein 1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
FCRL1 and IDBG-103709 and ENSG00000163534 and 115350, FCRL1 and IDBG-631097 and ENSBTAG00000005891 and 517846, Fcrl1 and IDBG-157118 and ENSMUSG00000059994 and 229499, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding, Fc receptor-like 1 |
| Identity: |
18509 |
| Gene: |
FCRL1 |
More about : FCRL1 |
| Long gene name: |
Fc receptor like 1 |
| Synonyms gene name: |
Fc receptor-like 1 |
| Synonyms: |
FCRH1 IRTA5 IFGP1 CD307a |
| Locus: |
1q23, 1 |
| Discovery year: |
2005-03-22 |
| GenBank acession: |
BC033690 |
| Entrez gene record: |
115350 |
| Pubmed identfication: |
11493702 11929751 |
| RefSeq identity: |
NM_052938 |
| Classification: |
CD molecules Immunoglobulin like domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000019398 |