Recombinant Human Fc Receptor-Like Protein 1, FCRL1, CD307a (C-6His)

Contact us
Catalog number: C607
Price: 369 €
Supplier: novo
Product name: Recombinant Human Fc Receptor-Like Protein 1, FCRL1, CD307a (C-6His)
Quantity: 50 µg
Other quantities: 1 mg 2283€ 50 µg 273€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human FcRL1 is produced by our Mammalian expression system and the target gene encoding Ala17-Asn303 is expressed with a 6His tag at the C-terminus
Molecular Weight: 24 kD, 32
UniProt number: Q96LA6
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 1 mM EDTA, 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGARSNVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD307a (C-6His), FCRL1, Fc Receptor-Like Protein 1
Short name: CD307a (C-6His), FCRL1, Recombinant Fc Receptor-Like Protein 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD307a (C-6His), fragment c receptor-like 1, sapiens fragment c Receptor-Like Protein 1, recombinant H
Alternative technique: rec
Alternative to gene target: FCRL1 and IDBG-103709 and ENSG00000163534 and 115350, FCRL1 and IDBG-631097 and ENSBTAG00000005891 and 517846, Fcrl1 and IDBG-157118 and ENSMUSG00000059994 and 229499, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding, Fc receptor-like 1
Identity: 18509
Gene: FCRL1 | More about : FCRL1
Long gene name: Fc receptor like 1
Synonyms gene name: Fc receptor-like 1
Synonyms: FCRH1 IRTA5 IFGP1 CD307a
Locus: 1q23, 1
Discovery year: 2005-03-22
GenBank acession: BC033690
Entrez gene record: 115350
Pubmed identfication: 11493702 11929751
RefSeq identity: NM_052938
Classification: CD molecules Immunoglobulin like domain containing
Havana BLAST/BLAT: OTTHUMG00000019398

Related Products :

C607 Recombinant Human Fc Receptor-Like Protein 1, FCRL1, CD307a (C-6His) 50 µg 273 € novo human
CP47 Recombinant Mouse Fc Receptor-like Protein 1, FCRL1, FcRH1 (C-6His) 50 µg 303 € novo mouse
RP-0676H Recombinant Human FCRL1 / FCRH1 Protein (His Tag) 50μg 624 € adv human
RP-1282M Recombinant Mouse FCRL1 / FCRH1 Protein (His Tag) 50μg 624 € adv mouse
LV159036 FCRL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV159037 FCRL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV159038 FCRL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV159039 FCRL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV159041 FCRL1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV159040 FCRL1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bdeee7c0e64 Anti- FCRL1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdeee80dd7f Anti- FCRL1 Antibody 0.12 ml 348 € MBS Polyclonals human
abx916711 Anti-FCRL1 siRNA 15 nmol 528 € abbex human
abx916712 Anti-FCRL1 siRNA 30 nmol 717 € abbex human
GWB-MR831C FCRL1 antibody 1 vial 440 € genways human
R36048-100UG FCRL1 Antibody 0.1mg 406 € NJS poly human
R36126-100UG FCRL1 Antibody 0.1mg 406 € NJS poly human
GWB-B54AFB FCRL1 Over-expression Lysate reagent 1 vial 463 € genways human
MBS615516 APJ Receptor (APLNR, Apelin receptor, AGTRL1, angiotensin II receptor-like 1, Angiotensin receptor-like 1, Apelin receptor, APJ, APJR, FLJ90771, G-protein coupled receptor APJ, HG11, MGC45246) Antibody 0.05 ml 536 € MBS Polyclonals_1 human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
MBS621839 TBP-like Protein (TBP Like Protein TLP, TLP, TATA Box Binding Protein-like Protein 1, TBP-like 1, TBP-like Protein 1, TBPL1, 21kDa TBP-like Protein, Second TBP of Unique DNA, STUD, TATA Box Binding Protein-related Factor 2, TBP-related Factor 2, TRF2, TLF Antibody 100ug 735 € MBS Polyclonals_1 human
MBS613784 PAEL Receptor (GPR37, G Protein Coupled Receptor 37, ETBR-LP-1, Endothelin B Receptor-like Protein 1, PAELR, Parkin-Associated Endothelin Receptor-Like Receptor) 50ug 724 € MBS Polyclonals_1 human
MBS610724 TLR5 (Toll Like Receptor 5, Toll-like Receptor 5 Precursor, TLR 5, TLR-5, FLJ10052, MGC126430, MGC126431, Toll/interleukin 1 Receptor-like Protein 3, TIL3) 100ug 730 € MBS Polyclonals_1 human
MBS610221 TLR5 (Toll Like Receptor 5, Toll-like Receptor 5 Precursor, TLR 5, TLR-5, FLJ10052, MGC126430, MGC126431, Toll/interleukin 1 Receptor-like Protein 3, TIL3) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS623300 EphA4 (Ephrin Receptor Eph A4, Ephrin Receptor EphA4, Ephrin Type A Receptor 4, EPH Receptor A4, Eph A4, EPH-like Kinase 8, EK8, HEK8, Receptor Protein Tyrosine Kinase HEK8, SEK, TYRO1 Protein Tyrosine Kinase, Tyrosine Protein Kinase Receptor SEK, Tyrosin Antibody 50ug 928 € MBS Polyclonals_1 human
C269 Recombinant Human GABA Receptor-Associated Protein-Like 1, GABARAPL1 (N-6His) 1 mg 2283 € novo human
MBS622505 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Ox-1-R, Ox1-R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) Antibody 100ug 652 € MBS Polyclonals_1 human
CI84 Recombinant Human IL-1 Receptor-Like 1, IL-1RL1, ST2 (C-6His) 10 µg 100 € novo human
CI17 Recombinant Human IL-1 Receptor-Like 2, IL-1RL2 (C-6His) 1 mg 2283 € novo human
CA47 Recombinant Human Leukocyte Ig-Like Receptor A2, LILRA2, ILT1, CD85h (C-6His) 50 µg 369 € novo human