Recombinant Human Corneodesmosin, CDSN (C-6His)

Contact us
Catalog number: C590
Price: 1613 €
Supplier: novo
Product name: Recombinant Human Corneodesmosin, CDSN (C-6His)
Quantity: 500 µg
Other quantities: 10 µg 121€ 50 µg 263€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Corneodesmosin is produced by our Mammalian expression system and the target gene encoding Lys33-Pro528 is expressed with a 6His tag at the C-terminus
Molecular Weight: 3 kD, 49
UniProt number: Q15517
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: KSIGTFSDPCKDPTRITSPNDPCLTGKGDSSGFSSYSGSSSSGSSISSARSSGGGSSGSSSGSSIAQGGSAGSFKPGTGYSQVSYSSGSGSSLQGASGSSQLGSSSSHSGSSGSHSGSSSHSSSSSSFQFSSSSFQVGNGSALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPGVVQGPPCSNGGLPGKPCPPITSVDKSYGGYEVVGGSSDSYLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNPIIPSQSAASSAIAFQPVGTGGVQLCGGGSTGSKGPCSPSSSRVPSSSSISGSSGLPYHPCGSASQSPCSPPGTGSFSSSSSSQSSGKIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSAGKIPCRSIRDILAQVKPLGPQLADPEVFLPQGELLDSPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CDSN (C-6His), Corneodesmosin
Short name: CDSN (C-6His), Recombinant Corneodesmosin
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: corneodesmosin (C-6His), sapiens Corneodesmosin, recombinant H
Alternative technique: rec
Alternative to gene target: BT, CDSN and IDBG-77127 and ENSG00000204539 and 1041, Cdsn and IDBG-178595 and ENSMUSG00000039518 and 386463, D6S586E and HTSS and HTSS1 and HYPT2 and PSS and S, multiple, this GO :0043589 and skin morphogenesis and biological process, 93339 and IDBG-634298 and ENSBTAG00000021721 and 522351, corneodesmosin
Identity: 1802
Gene: CDSN | More about : CDSN
Long gene name: corneodesmosin
Synonyms: D6S586E
Locus: 6p21, 33
Discovery year: 1998-05-14
GenBank acession: AF030130
Entrez gene record: 1041
Pubmed identfication: 9395522 8415725
Havana BLAST/BLAT: OTTHUMG00000031150

Related Products :

C590 Recombinant Human Corneodesmosin, CDSN (C-6His) 10 µg 121 € novo human
abx570571 Anti-Human Corneodesmosin (CDSN) ELISA Kit inquire 50 € abbex human
DL-CDSN-Hu Human Corneodesmosin CDSN ELISA Kit 96T 904 € DL elisas human
AP54866PU-N anti-Corneodesmosin / CDSN Antibody 0,1 mg 659 € acr human
MBS622812 Corneodesmosin (CDSN, D6S586E, HTSS, S protein) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS624321 Corneodesmosin (CDSN, S Protein) (Biotin) 50ug 818 € MBS Polyclonals_1 human
AE50930PI-48 ELISA test for Pig Corneodesmosin (CDSN) 1x plate of 48 wells 402 € abebio pig
GENTAUR-58ba4621a6959 Pig Corneodesmosin (CDSN) 100ug 1680 € MBS Recombinant Proteins pig
GENTAUR-58ba4622175c5 Pig Corneodesmosin (CDSN) 1000ug 1680 € MBS Recombinant Proteins pig
GENTAUR-58ba4622f1763 Pig Corneodesmosin (CDSN) 100ug 2194 € MBS Recombinant Proteins pig
GENTAUR-58ba46235117d Pig Corneodesmosin (CDSN) 1000ug 2194 € MBS Recombinant Proteins pig
AE50930PI-96 Pig Corneodesmosin (CDSN) ELISA Kit 1x plate of 96 wells 671 € abebio pig
abx156900 Anti-Human Corneodesmosin ELISA Kit inquire 50 € abbex human
abx252173 Anti-Human Corneodesmosin ELISA Kit inquire 50 € abbex human
R35502-100UG Corneodesmosin Antibody 0.1mg 406 € NJS poly human
LV115159 CDSN Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV115160 CDSN Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV115161 CDSN Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV115162 CDSN Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV115164 CDSN Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV115163 CDSN Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bdf9a94d300 Anti- CDSN Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf9a9c01a8 Anti- CDSN Antibody 0.12 ml 348 € MBS Polyclonals human
abx911356 Anti-CDSN siRNA inquire 50 € abbex human
abx911357 Anti-CDSN siRNA 30 nmol 717 € abbex human
MBS423448 Goat anti-CDSN Antibody 100ug 370 € MBS Polyclonals_1 human
C846 Recombinant Human Galectin-3, LGALS3 (C-6His, Human Cells) 50 µg 303 € novo human
CC79 Recombinant Human GM-CSF, CSF2 (C-6His, Human Cells) 10 µg 146 € novo human
CD98 Recombinant Human NGAL, Lipocalin-2, LCN2 (C-6His, Human Cells) 500 µg 1613 € novo human
CB01 Recombinant Human SOD2, Mn-SOD (C-6His, Human Cells) 500 µg 1613 € novo human