Recombinant Human CEACAM8, CD66b (C-6His)

Contact us
Catalog number: C583
Price: 789 €
Supplier: abbex
Product name: Recombinant Human CEACAM8, CD66b (C-6His)
Quantity: 96 tests
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CEACAM8 is produced by our Mammalian expression system and the target gene encoding Gln35-His141 is expressed with a 6His tag at the C-terminus
Molecular Weight: 03 kD, 13
UniProt number: P31997
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD66b (C-6His), CEACAM8
Short name: CD66b (C-6His), Recombinant CEACAM8
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD66b (C-6His), sapiens carcinoembryonic protein-related cellular adhesion molecule 8, recombinant H
Alternative technique: rec
Alternative to gene target: CD66b and CD67 and CGM6 and NCA-95, CEACAM8 and IDBG-54589 and ENSG00000124469 and 1088, Extracellular, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0031225 and anchored component of membrane and cellular component this GO :0045087 and innate immune response and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, carcinoembryonic antigen-related cell adhesion molecule 8
Identity: 1820
Gene: CEACAM8 | More about : CEACAM8
Long gene name: carcinoembryonic antigen related cell adhesion molecule 8
Synonyms gene: CGM6
Synonyms gene name: carcinoembryonic antigen-related cell adhesion molecule 8
Synonyms: CD66b
Locus: 19q13, 2
Discovery year: 1991-09-12
GenBank acession: D90064
Entrez gene record: 1088
Pubmed identfication: 2208113 2306228
Classification: Immunoglobulin like domain containing CD molecules V-set domain containing Carcinoembryonic antigen related cell adhesion molecule family
Havana BLAST/BLAT: OTTHUMG00000151124

Related Products :

C583 Recombinant Human CEACAM8, CD66b (C-6His) 1 mg 2283 € novo human
RP-0400H Recombinant Human CEACAM8 / CD66b Protein (His Tag) 50μg 624 € adv human
GENTAUR-58bde7867f3a8 Mouse Monoclonal [clone 80H3] (IgG1) to Human CEACAM8 / CD66b Antibody 100ug 597 € MBS mono human
CPA1221-100ul anti-CD66b / CEACAM8 Antibody 0,1 ml 442 € acr human
CPA1221-200ul anti-CD66b / CEACAM8 Antibody 0,2 ml 688 € acr human
CPA1221-30ul anti-CD66b / CEACAM8 Antibody 30 Вµl 326 € acr human
DM1229 anti-CD66b / CEACAM8 Antibody 0,1 mg 572 € acr human
SM1154F anti-CD66b / CEACAM8 Antibody 100 Tests 746 € acr human
SM1154P anti-CD66b / CEACAM8 Antibody 0,2 mg 674 € acr human
SM1154PT anti-CD66b / CEACAM8 Antibody 20 Вµg 340 € acr human
OBT0571F CD66b, 100kD, Clone: 80H3, Mouse Monoclonal antibody-Human, FITC; flow 100 tests Ask price € accurate-monoclonals human
ACYT66BF CD66b-FITC, Mouse Monoclonal antibody-Human, Clone: 80H3 1000ul 1347 € accurate-monoclonals human
YSRTMCA216T CD66b, Granulocyte, CEA gene member 6 (CGM6), p100, Clone: 80H3, Mouse Monoclonal antibody-Human 20 ug 177 € accurate-monoclonals human
YSRTMCA216F CD66b, Granulocyte, CEA gene member 6 (CGM6), p100, Clone: 80H3, Mouse Monoclonal antibody-Human, FITC; flow vial 532 € accurate-monoclonals human
YSRTMCA216 CD66b, Granulocyte, CEA gene member 6 (CGM6), p100, Clone: 80H3, Mouse Monoclonal antibody-Human; frozen, IH/flow 200ug 462 € accurate-monoclonals human
CLBM1546 CD66b, Granulocyte, gp100, PI-linked, Clone: CLB-B13.9, Mouse Monoclonal antibody-Human 1000ul 674 € accurate-monoclonals human
CLBM1594 CD66b, Granulocyte, gp100, PI-linked, Clone: CLB-B13.9, Mouse Monoclonal antibody-Human, FITC 1000ul 674 € accurate-monoclonals human
YM1052 CD66b, Granulocyte, Metamyelocyte, CML (chronic phase), 100kD, Clone: BL-B7, Mouse Monoclonal antibody-Human; NO paraffin 1000ul Ask price € accurate-monoclonals human
GENTAUR-58bddfd8a468f MOUSE Anti-HUMAN CD66b Antibody 200ug 503 € MBS mono human
GENTAUR-58bde2df67e43 MOUSE Anti-HUMAN CD66b Antibody 0.02 miligrams 249 € MBS mono human
GENTAUR-58be2a97b811b CD66b antibody 100ug 486 € MBS mono human
GWB-33C935 CD66b antibody 1 x 1 vial 602 € genways human
GWB-9DE9F2 CD66b antibody 1 vial 532 € genways human
GWB-C3701B CD66b antibody 1 vial 896 € genways human
GWB-E5F209 CD66b antibody 1 vial 267 € genways human
GWB-8A2D36 CD66b antibody (FITC conjugated) 1 vial 683 € genways human
GENTAUR-58be18add5db8 MAb to CD66b 100kDa Antibody 200ug 597 € MBS mono human
GENTAUR-58be18b48e0cd MAb to CD66b (Formerly CD67) Antibody 100 Tests 719 € MBS mono human
abx151026 Anti-Human CEACAM8 ELISA Kit inquire 50 € abbex human
abx574940 Anti-Human CEACAM8 ELISA Kit 96 tests 789 € abbex human