| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
This transmembrane glycoprotein is detected by monoclonals and has a lot of clones available with different affinity, Cytotoxic T cells cluster differentiators for flow cytometry |
| Molecular Weight: |
17, 8 kD |
| UniProt number: |
P10966 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD8B (C-6His), Chain, CD8 &beta |
| Short name: |
CD8B (C-6His), Chain, Recombinant CD8 &beta |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
CD8b molecule (C-6His), epitope, sapiens CD8 &beta, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD8B and IDBG-60041 and ENSG00000172116 and 100996919, CD8B and IDBG-634906 and ENSBTAG00000008956 and 508633, Cd8b1 and IDBG-155547 and ENSMUSG00000053044 and 12526, Extracellular, MHC class I protein binding, this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0015026 and coreceptor activity and molecular function this GO :0016032 and viral process and biological process this GO :0031901 and early endosome membrane and cellular component this GO :0042101 and T cell receptor complex and cellular component this GO :0042110 and T cell activation and biological process this GO :0042288 and MHC class I protein binding and molecular function this GO :0050690 and regulation of defense response to virus by virus and biological process this GO :0050776 and regulation of immune response and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0015026 : coreceptor activity and also this GO :0042288 : MHC class I protein binding, this GO :0015026 : coreceptor activity, this GO :0042288 : MHC class I protein binding, 926, CD8b molecule |
| Identity: |
1707 |
| Gene: |
CD8B |
More about : CD8B |
| Long gene name: |
CD8b molecule |
| Synonyms gene: |
CD8B1 |
| Synonyms gene name: |
CD8 antigen, beta polypeptide 1 (p37) |
| Locus: |
2p11, 2 |
| Discovery year: |
1989-04-13 |
| Entrez gene record: |
926 |
| Pubmed identfication: |
1541829 |
| RefSeq identity: |
NM_172099 |
| Classification: |
CD molecules V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000130264 |