Recombinant Human CD8 β Chain, CD8B (C-6His)

Contact us
Catalog number: C581
Price: 572 €
Supplier: adv
Product name: Recombinant Human CD8 β Chain, CD8B (C-6His)
Quantity: 20μg
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: This transmembrane glycoprotein is detected by monoclonals and has a lot of clones available with different affinity, Cytotoxic T cells cluster differentiators for flow cytometry
Molecular Weight: 17, 8 kD
UniProt number: P10966
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD8B (C-6His), Chain, CD8 &beta
Short name: CD8B (C-6His), Chain, Recombinant CD8 &beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: CD8b molecule (C-6His), epitope, sapiens CD8 &beta, recombinant H
Alternative technique: rec
Alternative to gene target: CD8B and IDBG-60041 and ENSG00000172116 and 100996919, CD8B and IDBG-634906 and ENSBTAG00000008956 and 508633, Cd8b1 and IDBG-155547 and ENSMUSG00000053044 and 12526, Extracellular, MHC class I protein binding, this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0015026 and coreceptor activity and molecular function this GO :0016032 and viral process and biological process this GO :0031901 and early endosome membrane and cellular component this GO :0042101 and T cell receptor complex and cellular component this GO :0042110 and T cell activation and biological process this GO :0042288 and MHC class I protein binding and molecular function this GO :0050690 and regulation of defense response to virus by virus and biological process this GO :0050776 and regulation of immune response and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0015026 : coreceptor activity and also this GO :0042288 : MHC class I protein binding, this GO :0015026 : coreceptor activity, this GO :0042288 : MHC class I protein binding, 926, CD8b molecule
Identity: 1707
Gene: CD8B | More about : CD8B
Long gene name: CD8b molecule
Synonyms gene: CD8B1
Synonyms gene name: CD8 antigen, beta polypeptide 1 (p37)
Locus: 2p11, 2
Discovery year: 1989-04-13
Entrez gene record: 926
Pubmed identfication: 1541829
RefSeq identity: NM_172099
Classification: CD molecules V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000130264

Related Products :

C581 Recombinant Human CD8 β Chain, CD8B (C-6His) 50 µg 369 € novo human
GENTAUR-58be260d2c044 Anti-Mouse CD8b (Ly 3), APC (Clone CT-CD8b) (rat IgG2a) 100ug 431 € MBS mono mouse
GENTAUR-58be260d8cc76 Anti-Mouse CD8b (Ly 3), Biotin (Clone CT-CD8b) (rat IgG2a) 0.3 miligrams 503 € MBS mono mouse
GENTAUR-58be260e078f6 Anti-Mouse CD8b (Ly 3), Biotin (Clone CT-CD8b) (rat IgG2a) 100ug 326 € MBS mono mouse
GENTAUR-58be260e6516f Anti-Mouse CD8b (Ly 3), FITC (Clone CT-CD8b) (rat IgG2a) 0.3 miligrams 503 € MBS mono mouse
GENTAUR-58be260ecc659 Anti-Mouse CD8b (Ly 3), FITC (Clone CT-CD8b) (rat IgG2a) 100ug 326 € MBS mono mouse
GENTAUR-58be260f43c61 Anti-Mouse CD8b (Ly 3), PE (Clone CT-CD8b) (rat IgG2a) 50ug 332 € MBS mono mouse
GENTAUR-58be260fb6ceb Anti-Mouse CD8b (Ly 3), PE-Cy5 (Clone CT-CD8b) (rat IgG2a) 100ug 431 € MBS mono mouse
GENTAUR-58be261027370 Anti-Mouse CD8b (Ly 3), Purified (Clone CT-CD8b) (rat IgG2a) 200ug 370 € MBS mono mouse
ACL8938AP CD8b, Ly 3, Clone: CT-CD8b, Rat Mouse Monoclonal antibody-Mouse 0.2mg 296 € accurate-monoclonals mouse
ACL8938APC CD8b, Ly 3, Clone: CT-CD8b, Rat Mouse Monoclonal antibody-Mouse, APC 0.1mg 374 € accurate-monoclonals mouse
ACL8938B CD8b, Ly 3, Clone: CT-CD8b, Rat Mouse Monoclonal antibody-Mouse, Biotin 0.1mg 235 € accurate-monoclonals mouse
ACL8938B-3 CD8b, Ly 3, Clone: CT-CD8b, Rat Mouse Monoclonal antibody-Mouse, Biotin 0.3mg 456 € accurate-monoclonals mouse
ACL8938F CD8b, Ly 3, Clone: CT-CD8b, Rat Mouse Monoclonal antibody-Mouse, FITC 0.1mg 235 € accurate-monoclonals mouse
ACL8938F-3 CD8b, Ly 3, Clone: CT-CD8b, Rat Mouse Monoclonal antibody-Mouse, FITC 0.3mg 456 € accurate-monoclonals mouse
ACL8938PE CD8b, Ly 3, Clone: CT-CD8b, Rat Mouse Monoclonal antibody-Mouse, PE 50 ug 234 € accurate-monoclonals mouse
ACL8938PE-3 CD8b, Ly 3, Clone: CT-CD8b, Rat Mouse Monoclonal antibody-Mouse, PE 0.3mg 691 € accurate-monoclonals mouse
ACL8938TC CD8b, Ly 3, Clone: CT-CD8b, Rat Mouse Monoclonal antibody-Mouse, PE-Cy5 0.1mg 374 € accurate-monoclonals mouse
YSRTMCA1362F CD8b, Ly-3.1, Clone: CT-CD8b, Rat Mouse Monoclonal antibody-Mouse, FITC; flow 0.1 mg Ask price € accurate-monoclonals mouse
MCD008B-APC Rat Monoclonal Anti-Mouse CD8b (Ly 3), APC (Clone CT-CD8b) (rat IgG2a) 50 tests 478 € adi mouse
MCD008B-B Rat Monoclonal Anti-Mouse CD8b (Ly 3) , Biotin (Clone CT-CD8b) (rat IgG2a) 100 tests 550 € adi mouse
MCD008B-F Rat Monoclonal Anti-Mouse CD8b (Ly 3), FITC (Clone CT-CD8b) (rat IgG2a) 100 tests 550 € adi mouse
MCD008B-PE Rat Monoclonal Anti-Mouse CD8b (Ly 3), PE (Clone CT-CD8b) (rat IgG2a) 100 tests 550 € adi mouse
MCD008B-PC5 Rat Monoclonal Anti-Mouse CD8b (Ly 3), PE-Cy5 (Clone CT-CD8b) (rat IgG2a) 50 tests 405 € adi mouse
MCD008B-M Rat Monoclonal Anti-Mouse CD8b (Ly 3) Purified (Clone CT-CD8b) (rat2a) 100 μg 565 € adi mouse
GENTAUR-58bc86112c1ef Pongo pygmaeus T-cell surface glycoprotein CD8 beta chain (CD8B) 100ug 1492 € MBS Recombinant Proteins human
GENTAUR-58bc86116de36 Pongo pygmaeus T-cell surface glycoprotein CD8 beta chain (CD8B) 1000ug 1492 € MBS Recombinant Proteins human
GENTAUR-58bc8611b0fd2 Pongo pygmaeus T-cell surface glycoprotein CD8 beta chain (CD8B) 100ug 1995 € MBS Recombinant Proteins human
GENTAUR-58bc86120e645 Pongo pygmaeus T-cell surface glycoprotein CD8 beta chain (CD8B) 1000ug 1995 € MBS Recombinant Proteins human
RP-0376H Recombinant Human CD8B / P37 / LEU2 Protein (Fc Tag) 20μg 572 € adv human