Recombinant Human Leukocyte Ig-Like Receptor B1, LILRB1, ILT2, CD85j (C-6His)

Contact us
Catalog number: C484
Price: 205 €
Supplier: MBS mono
Product name: Recombinant Human Leukocyte Ig-Like Receptor B1, LILRB1, ILT2, CD85j (C-6His)
Quantity: 0.025 miligrams
Other quantities: 10 µg 121€ 50 µg 263€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human LILRB1 is produced by our Mammalian expression system and the target gene encoding Gly24-His458 is expressed with a 6His tag at the C-terminus
Molecular Weight: 24 kD, 48
UniProt number: Q8NHL6
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD85j (C-6His), ILT2, LILRB1, Leukocyte Ig-Like Receptor B1
Short name: CD85j (C-6His), ILT2, LILRB1, Recombinant Leukocyte Ig-Like Receptor B1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD85j (C-6His), ILT2, leukocyte immunoglobulin-like receptor, member 1, sapiens Leukocyte Ig-Like Receptor B1, subfamily B (including TM and ITIM domains), recombinant H
Alternative technique: rec
Alternative to gene target: CD85J and ILT-2 and ILT2 and LIR-1 and LIR1 and MIR-7 and MIR7, Cell surfaces, LILRB1 and IDBG-68880 and ENSG00000104972 and 10859, alpha-beta T cell activation and biological process this GO :2001189 and negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell and biological process this GO :2001193 and positive regulation of gamma-delta T cell activation involved in immune response and biological process this GO :2001199 and negative regulation of dendritic cell differentiation and biological process this GO :2001202 and negative regulation of transforming growth factor-beta secretion and biological process this GO :2001205 and negative regulation of osteoclast development and biological process, member 1, protein homodimerization activity, subfamily B (with TM and ITIM domains), this GO :0001915 and negative regulation of T cell mediated cytotoxicity and biological process this GO :0002230 and positive regulation of defense response to virus by host and biological process this GO :0002309 and T cell proliferation involved in immune response and biological process this GO :0002740 and negative regulation of cytokine secretion involved in immune response and biological process this GO :0002767 and immune response-inhibiting cell surface receptor signaling pathway and biological process this GO :0002774 and Fc receptor mediated inhibitory signaling pathway and biological process this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0007165 and signal transduction and biological process this GO :0008157 and protein phosphatase 1 binding and molecular function this GO :0009615 and response to virus and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0010628 and positive regulation of gene expression and biological process this GO :0014063 and negative regulation of serotonin secretion and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0030107 and HLA-A specific inhibitory MHC class I receptor activity and molecular function this GO :0030109 and HLA-B specific inhibitory MHC class I receptor activity and molecular function this GO :0031623 and receptor internalization and biological process this GO :0032393 and MHC class I receptor activity and molecular function this GO :0032609 and interferon-gamma production and biological process this GO :0032689 and negative regulation of interferon-gamma production and biological process this GO :0032945 and negative regulation of mononuclear cell proliferation and biological process this GO :0035548 and negative regulation of interferon-beta secretion and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0042169 and SH2 domain binding and molecular function this GO :0042288 and MHC class I protein binding and molecular function this GO :0042536 and negative regulation of tumor necrosis factor biosynthetic process and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0045077 and negative regulation of interferon-gamma biosynthetic process and biological process this GO :0045786 and negative regulation of cell cycle and biological process this GO :0045806 and negative regulation of endocytosis and biological process this GO :0045919 and positive regulation of cytolysis and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0045953 and negative regulation of natural killer cell mediated cytotoxicity and biological process this GO :0046636 and negative regulation of alpha-beta T cell activation and biological process this GO :0050776 and regulation of immune response and biological process this GO :0051607 and defense response to virus and biological process this GO :0051926 and negative regulation of calcium ion transport and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0072643 and interferon-gamma secretion and biological process this GO :0097028 and dendritic cell differentiation and biological process this GO :2000669 and negative regulation of dendritic cell apoptotic process and biological process this GO :2001180 and negative regulation of interleukin-10 secretion and biological process this GO :2001183 and negative regulation of interleukin-12 secretion and biological process this GO :2001186 and negative regulation of CD8-positive, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0008157 : protein phosphatase 1 binding and also this GO :0030107 : HLA-A specific inhibitory MHC class I receptor activity and also this GO :0030109 : HLA-B specific inhibitory MHC class I receptor activity and also this GO :0032393 : MHC class I receptor activity and also this GO :0042169 : SH2 domain binding and also this GO :0042288 : MHC class I protein binding and also this GO :0042803 : protein homodimerization activity, this GO :0008157 : protein phosphatase 1 binding, this GO :0030107 : HLA-A specific inhibitory MHC class I receptor activity, this GO :0030109 : HLA-B specific inhibitory MHC class I receptor activity, this GO :0032393 : MHC class I receptor activity, this GO :0042169 : SH2 domain binding, this GO :0042288 : MHC class I protein binding, this GO :0042803 : protein homodimerization activity, leukocyte immunoglobulin-like receptor
Identity: 6605
Gene: LILRB1 | More about : LILRB1
Long gene name: leukocyte immunoglobulin like receptor B1
Synonyms gene name: leukocyte immunoglobulin-like receptor, member 1 , subfamily B (with TM and ITIM domains)
Synonyms: LIR-1 ILT2 MIR-7 CD85 LIR1 CD85j PIRB PIR-B
Synonyms name: myeloid inhibitory receptor 7 leucocyte Ig-like receptor B1
Locus: 19q13, 42
Discovery year: 2000-01-11
GenBank acession: AF009220
Entrez gene record: 10859
Pubmed identfication: 9285411 9382880
Classification: Inhibitory leukocyte immunoglobulin like receptors CD molecules
Havana BLAST/BLAT: OTTHUMG00000065695

Related Products :

C484 Recombinant Human Leukocyte Ig-Like Receptor B1, LILRB1, ILT2, CD85j (C-6His) 500 µg 1613 € novo human
RP-0371H Recombinant Human LILRB1 / CD85 / ILT2 / ILR1 Protein (His Tag) 50μg 624 € adv human
AM05585FC-N anti-CD85j / LILRB1 Antibody 0,1 mg 601 € acr human
AM05585FC-T anti-CD85j / LILRB1 Antibody 25 Вµg 326 € acr human
AM05585PU-L anti-CD85j / LILRB1 Antibody 0,2 mg 746 € acr human
AM05585PU-N anti-CD85j / LILRB1 Antibody 0,1 mg 456 € acr human
AM05585PU-T anti-CD85j / LILRB1 Antibody 25 Вµg 311 € acr human
AM05585RP-N anti-CD85j / LILRB1 Antibody 100 Tests 732 € acr human
AM26748LE-N anti-CD85j / LILRB1 Antibody 0,1 mg 355 € acr human
AM26748PU-N anti-CD85j / LILRB1 Antibody 0,1 mg 355 € acr human
AM26748RP-N anti-CD85j / LILRB1 Antibody 100 Tests 471 € acr human
GENTAUR-58bdd41a55971 Anti- Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 1 (LILRB1) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd8e654a58 Anti- Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 1 (LILRB1) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bddc98d963d Anti- Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 1 (LILRB1) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bddc99365e1 Anti- Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 1 (LILRB1) Antibody 50ug 365 € MBS Polyclonals human
MBS620347 SLP-76, NT (SH2 Domain Containing Leukocyte Protein 76 kD, SH2 Domain-containing Leukocyte Protein of 76kD, SH2 Domain Containing Leukocyte Protein of 76kDa, SLP76, SLP76 Tyrosine Phosphoprotein, SLP-76 Tyrosine Phosphoprotein, 76kD Tyrosine Phosphoprotei 100ug 763 € MBS Polyclonals_1 human
CA47 Recombinant Human Leukocyte Ig-Like Receptor A2, LILRA2, ILT1, CD85h (C-6His) 50 µg 369 € novo human
CC83 Recombinant Human Leukocyte Ig-Like Receptor A3, LILRA3, ILT6, CD85e (C-6His) 10 µg 146 € novo human
C485 Recombinant Human Leukocyte Ig-Like Receptor B2, LILRB2, ILT4, CD85d (C-6His) 10 µg 121 € novo human
C574 Recombinant Human Leukocyte Mono Ig-Like Receptor 1, LMIR1, CD300a (C-6His) 50 µg 303 € novo human
CD41 Recombinant Human Leukocyte Mono Ig-Like Receptor 1, LMIR1, CD300a (C-Fc-6His) 10 µg 146 € novo human
C443 Recombinant Human Leukocyte Mono Ig-Like Receptor 2, LMIR2, CD300C (C-6His) 50 µg 273 € novo human
CJ01 Recombinant Human Leukocyte Elastase Inhibitor, Serpin B1, SERPINB1 (C-6His) 1 mg 2283 € novo human
RP-879 Recombinant (E.Coli) Human Leukocyte-Associated Ig-Like Receptor 1 5 μg 188 € adi human
CD16 Recombinant Human Leukocyte Mono Ig-Like Receptor 2, LMIR2, CD300C (C-Fc) 50 µg 303 € novo human
MBS615516 APJ Receptor (APLNR, Apelin receptor, AGTRL1, angiotensin II receptor-like 1, Angiotensin receptor-like 1, Apelin receptor, APJ, APJR, FLJ90771, G-protein coupled receptor APJ, HG11, MGC45246) Antibody 0.05 ml 536 € MBS Polyclonals_1 human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
GENTAUR-58bde18477c30 MOUSE Anti-HUMAN CD85j Antibody 200ug 531 € MBS mono human
GENTAUR-58bde18551c14 MOUSE Anti-HUMAN CD85j Antibody 100ug 332 € MBS mono human
GENTAUR-58bde370c61c2 MOUSE Anti-HUMAN CD85j Antibody 0.025 miligrams 205 € MBS mono human