Recombinant Human Sialic Acid Binding Ig-Like Lectin 3, Siglec-3, CD33 (C-Fc-6His)

Contact us
Catalog number: C445
Price: 1923 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Sialic Acid Binding Ig-Like Lectin 3, Siglec-3, CD33 (C-Fc-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 131€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Human Sialic Acid Binding Ig-like Lectin 3 is produced by our Mammalian expression system and the target gene encoding Asp18-His259 is expressed with a Fc
Molecular Weight: 01 kD, 55
UniProt number: P20138
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 mM EDTA, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHTSDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD33 (C-Fc-6His), Siglec-3, Sialic Acid Binding Ig-Like Lectin 3
Short name: CD33 (C-Fc-6His), Siglec-3, Recombinant Sialic Acid Binding Ig-Like Lectin 3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD33 molecule (C-fragment c-6His), Siglec-3, sapiens Sialic Acid Binding Ig-Like Lectin 3, recombinant H
Alternative technique: rec
Alternative to gene target: CD33 and IDBG-65737 and ENSG00000105383 and 945, Cell surfaces, p67 and SIGLEC-3 and SIGLEC3, protein binding, this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, CD33 molecule
Identity: 1659
Gene: CD33 | More about : CD33
Long gene name: CD33 molecule
Synonyms gene name: CD33 antigen (gp67)
Synonyms: SIGLEC3 SIGLEC-3 p67 FLJ00391
Synonyms name: sialic acid binding Ig-like lectin 3
Locus: 19q13, 41
Discovery year: 1986-01-01
GenBank acession: M23197
Entrez gene record: 945
Pubmed identfication: 3139766 9465907
RefSeq identity: NM_001772
Classification: CD molecules Sialic acid binding Ig like lectins V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000182891

Related Products :

C445 Recombinant Human Sialic Acid Binding Ig-Like Lectin 3, Siglec-3, CD33 (C-Fc-6His) 500 µg 1613 € novo human
CJ10 Recombinant Mouse Sialic Acid Binding Ig-Like Lectin 3, Siglec-3, CD33 (C-6His) 1 mg 2283 € novo mouse
C788 Recombinant Human Sialic Acid-Binding Ig-Like Lectin 9, Siglec 9, CD329 (C-Fc) 10 µg 146 € novo human
MBS623641 SIGLEC8, CT (Sialic Acid-binding Ig-like Lectin 8, Siglec-8, Sialoadhesin Family Member 2, SAF-2, CDw329, CD329, SAF2) 200ul 603 € MBS Polyclonals_1 human
MBS619555 Galectin-1 (GAL1, LGALS1, GAL-1, Lectin galactoside-binding soluble 1, Beta-galactoside- binding lectin L-14-I, Lactose-binding lectin 1, S-Lac lectin 1, Galaptin, 14kD lectin, HPL, HBL, Putative MAPK-activating protein PM12, GBP, DKFZp686E23103) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS620576 Galectin-1 (GAL1, LGALS1, Lectin galactoside-binding soluble 1, Beta-galactoside- binding lectin L-14-I, Lactose-binding lectin 1, S-Lac lectin 1, Galaptin, HPL, HBL, Putative MAPK-activating protein PM12, GBP, DKFZp686E23103) (Biotin) Antibody 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58bde5648af11 MOUSE Anti-HUMAN SIGLEC-5/SIGLEC-14 Antibody 100ug 393 € MBS mono human
GENTAUR-58bde54f55538 MOUSE Anti-HUMAN SIGLEC-5/SIGLEC-14:FITC Antibody 100ug 448 € MBS mono human
GENTAUR-58bde51bb0bc5 MOUSE Anti-HUMAN SIGLEC-5/SIGLEC-14:RPE Antibody 100 Tests 475 € MBS mono human
abx167216 Anti-Sialic Acid Binding Ig Like Lectin 3 Protein (Recombinant) 50 μg 572 € abbex human
abx168235 Anti-Sialic Acid Binding Ig Like Lectin 8 Protein (Recombinant) 50 μg 615 € abbex human
RP-0319H Recombinant Human CD33 / Siglec-3 Protein (Fc Tag) 50μg 624 € adv human
RP-0320H Recombinant Human CD33 / Siglec-3 Protein (His Tag) 50μg 624 € adv human
RP-1127M Recombinant Mouse CD33 / Siglec-3 Protein (Fc Tag) 50μg 624 € adv mouse
RP-1126M Recombinant Mouse CD33 / Siglec-3 Protein (His Tag) 20μg 572 € adv mouse
abx250213 Anti-Human Sialic Acid Binding Ig Like Lectin 1 ELISA Kit 96 tests 557 € abbex human
abx250452 Anti-Human Sialic acid-binding Ig-like lectin 10 ELISA Kit inquire 50 € abbex human
abx253173 Anti-Human Sialic Acid Binding Ig Like Lectin 2 ELISA Kit 96 tests 557 € abbex human
abx253174 Anti-Human Sialic Acid Binding Ig Like Lectin 3 ELISA Kit inquire 50 € abbex human
abx156853 Anti-Human Sialic Acid Binding Ig Like Lectin 6 ELISA Kit inquire 50 € abbex human
abx156745 Anti-Human Sialic Acid Binding Ig Like Lectin 7 ELISA Kit inquire 50 € abbex human
abx253175 Anti-Human Sialic Acid Binding Ig Like Lectin 8 ELISA Kit inquire 50 € abbex human
DL-SIGLEC1-Hu Human Sialic Acid Binding Ig Like Lectin 1 SIGLEC1 ELISA Kit 96T 846 € DL elisas human
DL-SIGLEC10-Hu Human Sialic Acid Binding Ig Like Lectin 10 SIGLEC10 ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bd6c8432760 Human Sialic acid-binding Ig-like lectin 12 (SIGLEC12) 100ug 2288 € MBS Recombinant Proteins human
GENTAUR-58bd6c8486bf5 Human Sialic acid-binding Ig-like lectin 12 (SIGLEC12) 1000ug 2288 € MBS Recombinant Proteins human
GENTAUR-58bd6c84da4f6 Human Sialic acid-binding Ig-like lectin 12 (SIGLEC12) 100ug 2801 € MBS Recombinant Proteins human
GENTAUR-58bd6c8525d5d Human Sialic acid-binding Ig-like lectin 12 (SIGLEC12) 1000ug 2801 € MBS Recombinant Proteins human
DL-SIGLEC2-Hu Human Sialic Acid Binding Ig Like Lectin 2 SIGLEC2 ELISA Kit 96T 869 € DL elisas human
GENTAUR-58b9fc917cc1b Human Sialic acid-binding Ig-like lectin 6 (SIGLEC6) 100ug 1923 € MBS Recombinant Proteins human