Recombinant Human AGER, RAGE (C-6His)

Contact us
Catalog number: C423
Price: 827 €
Supplier: genways
Product name: Recombinant Human AGER, RAGE (C-6His)
Quantity: 1 vial
Other quantities: 1 mg 2283€ 50 µg 273€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human AGER is produced by our Mammalian expression system and the target gene encoding Ala23-Ala344 is expressed with a 6His tag at the C-terminus
Molecular Weight: 2 kD, 35
UniProt number: Q15109
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALAVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: RAGE (C-6His), AGER
Short name: RAGE (C-6His), Recombinant AGER
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: RAGE (C-6His), sapiens advanced glycosylation end product-specific receptor, recombinant H
Alternative technique: rec
Alternative to gene target: AGER and IDBG-633065 and ENSBTAG00000014420 and 280986, AGER and IDBG-80463 and ENSG00000204305 and 177, Ager and IDBG-172144 and ENSMUSG00000015452 and 11596, Extracellular, RAGE, S100 protein binding, this GO :0004872 and receptor activity and molecular function this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0009611 and response to wounding and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0031175 and neuron projection development and biological process this GO :0042802 and identical protein binding and molecular function this GO :0044548 and S100 protein binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0050930 and induction of positive chemotaxis and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding and also this GO :0044548 : S100 protein binding, this GO :0004888 : transmembrane signaling receptor activity, this GO :0005515 : protein binding, this GO :0042802 : identical protein binding, this GO :0044548 : S100 protein binding, advanced glycosylation end product-specific receptor
Identity: 320
Gene: AGER | More about : AGER
Long gene name: advanced glycosylation end-product specific receptor
Synonyms: RAGE SCARJ1
Synonyms name: receptor for advanced glycation end-products
Locus: 6p21, 32
Discovery year: 1994-10-17
GenBank acession: M91211
Entrez gene record: 177
Pubmed identfication: 7713518
RefSeq identity: NM_001136
Classification: C2-set domain containing Immunoglobulin like domain containing Scavenger receptors
Havana BLAST/BLAT: OTTHUMG00000031120

Related Products :

C423 Recombinant Human AGER, RAGE (C-6His) 10 µg 131 € novo human
RP-0035H Recombinant Human AGER / RAGE Protein 50μg 624 € adv human
RP-0036H Recombinant Human AGER / RAGE Protein (Fc Tag) 50μg 624 € adv human
RP-0034H Recombinant Human AGER / RAGE Protein (His Tag) 50μg 624 € adv human
RP-1013M Recombinant Mouse AGER / RAGE Protein (His Tag) 50μg 624 € adv mouse
MBS247493 Anti-Human AGER / RAGE Antibody 50ug 597 € MBS Polyclonals_1 human
AP02803SU-N anti-RAGE / AGER (42-59) Antibody 0,1 ml 833 € acr human
SP1305 anti-RAGE / AGER (42-59) Antibody 0,1 ml 688 € acr human
AP23365PU-N anti-RAGE / AGER Antibody 0,2 ml 543 € acr human
BB-PA1069 anti-RAGE / AGER Antibody 0,1 mg 471 € acr human
DM3593P anti-RAGE / AGER (Extracell. Dom.) Antibody 0,1 mg 688 € acr human
AP00826SU-N anti-RAGE / AGER (N-term) Antibody 0,2 ml 529 € acr human
AP12168PU-N anti-RAGE / AGER (N-term) Antibody 0,4 ml 587 € acr human
GWB-BBP091 Polyclonal antibody to or anti-AGER (RAGE) antibody 1 vial 463 € genways human
LV071005 AGER Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV071006 AGER Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV071007 AGER Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV071008 AGER Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV071010 AGER Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV071009 AGER Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
abx150586 Anti-Human AGER ELISA Kit 96 tests 847 € abbex human
abx570162 Anti-Human AGER ELISA Kit inquire 50 € abbex human
CEK1007 anti-Human AGER ELISA Kit Antibody 96 Tests 703 € acr human
DL-AGER-Hu Human Advanced Glycosylation End Product Specific Receptor AGER ELISA Kit 96T 846 € DL elisas human
101-M612 Anti-Human RAGE 100ug 336 € Reliatech antibodies human
BB-EK0827 anti-Human Rage ELISA Kit Antibody 96 Tests 804 € acr human
abx571511 Anti-Human Renal Tumor Antigen (RAGE) ELISA Kit inquire 50 € abbex human
GWB-F936C7 antibody to or anti- RAGE C-terminusinal Human antibody 1 vial 729 € genways human
MBS222435 GOAT ANTI HUMAN RAGE Antibody 100ul 486 € MBS Polyclonals_1 human
GWB-HX5B98 Human Rage 96 well plate ELISA assay Kit 1 vial 827 € genways human