| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human AGER is produced by our Mammalian expression system and the target gene encoding Ala23-Ala344 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
2 kD, 35 |
| UniProt number: |
Q15109 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALAVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
RAGE (C-6His), AGER |
| Short name: |
RAGE (C-6His), Recombinant AGER |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
RAGE (C-6His), sapiens advanced glycosylation end product-specific receptor, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
AGER and IDBG-633065 and ENSBTAG00000014420 and 280986, AGER and IDBG-80463 and ENSG00000204305 and 177, Ager and IDBG-172144 and ENSMUSG00000015452 and 11596, Extracellular, RAGE, S100 protein binding, this GO :0004872 and receptor activity and molecular function this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0009611 and response to wounding and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0031175 and neuron projection development and biological process this GO :0042802 and identical protein binding and molecular function this GO :0044548 and S100 protein binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0050930 and induction of positive chemotaxis and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding and also this GO :0044548 : S100 protein binding, this GO :0004888 : transmembrane signaling receptor activity, this GO :0005515 : protein binding, this GO :0042802 : identical protein binding, this GO :0044548 : S100 protein binding, advanced glycosylation end product-specific receptor |
| Identity: |
320 |
| Gene: |
AGER |
More about : AGER |
| Long gene name: |
advanced glycosylation end-product specific receptor |
| Synonyms: |
RAGE SCARJ1 |
| Synonyms name: |
receptor for advanced glycation end-products |
| Locus: |
6p21, 32 |
| Discovery year: |
1994-10-17 |
| GenBank acession: |
M91211 |
| Entrez gene record: |
177 |
| Pubmed identfication: |
7713518 |
| RefSeq identity: |
NM_001136 |
| Classification: |
C2-set domain containing Immunoglobulin like domain containing Scavenger receptors |
| Havana BLAST/BLAT: |
OTTHUMG00000031120 |