Recombinant Human Wnt Inhibitory Factor 1, WIF-1 (C-6His)

Contact us
Catalog number: C396
Price: 1420 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Wnt Inhibitory Factor 1, WIF-1 (C-6His)
Quantity: 1000ug
Other quantities: 1 mg 2283€ 10 µg 131€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Wnt Inhibitory Factor 1 is produced by our Mammalian expression system and the target gene encoding Gly29-Trp379 is expressed with a 6His tag at the C-terminus
Molecular Weight: 39, 47 kD
UniProt number: Q9Y5W5
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 0, 150 mM sodium chloride, pH 4, 2 um filtered solution of 10 mM HAc-NaAc, 5% CHAPS, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIWVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: WIF-1 (C-6His), Wnt Inhibitory Factor 1
Short name: WIF-1 (C-6His), Recombinant Wnt Inhibitory Factor 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: WIF-1 (C-6His), sapiens Wnt Inhibitory Factor 1, recombinant H
Alternative technique: rec

Related Products :

C396 Recombinant Human Wnt Inhibitory Factor 1, WIF-1 (C-6His) 10 µg 131 € novo human
103-M285 Anti-Mouse WIF-1 (Wnt inhibitory factor 1) 100ug 336 € Reliatech antibodies mouse
MBS622941 WISP1 (Wnt 1 induced Secreted Protein 1, Wnt-1-induced Secreted Protein 1, Wnt1-induced Secreted Protein 1, WISP 1, WISP-1, CCN4, WISP1c, WISP1i, WISP1tc, Wnt-1-induced Secreted Protein, Wnt1-induced Secreted Protein, Wnt-1-inducible Signaling Pathway Pro Antibody 100ug 591 € MBS Polyclonals_1 human
MBS623071 Wnt3 (Wingless-type MMTV (Mouse Mammary Tumor Virus) Integration Site Family Member 3, Wnt 3, Wnt-3, Wnt 3 Proto-oncogene Protein, Wnt3 Proto-oncogene Protein, Wnt-3 Proto-oncogene Protein Precursor, Int4, MGC131950, MGC138321, MGC138323) Antibody 100ug 735 € MBS Polyclonals_1 virus
RP-1600M Recombinant Mouse WIF1 / WIF-1 Protein (His Tag) 50μg 624 € adv mouse
GWB-P1732C Wif-1, 29-379aa, Recombinant Protein bulk Ask price € genways bulk human
101-M703 Anti-Human WIF-1 100ug 336 € Reliatech antibodies human
GWB-D4A606 Recombinant Human WNT Inhibitory Factor 1 bulk Ask price € genways bulk human
abx142307 Anti-WIF-1 Antibody 100 μl 383 € abbex human
abx168544 Anti-WNT Inhibitory Factor 1 Protein (Recombinant) 10 μg 427 € abbex human
abx260367 Anti-WNT Inhibitory Factor 1 Protein (Recombinant) 2 µg 398 € abbex human
abx190372 Anti-Human WNT Inhibitory Factor 1 CLIA Kit inquire 50 € abbex human
abx251600 Anti-Human Wnt inhibitory factor 1 ELISA Kit inquire 50 € abbex human
abx574904 Anti-Human WNT Inhibitory Factor 1 (WIF1) ELISA Kit 96 tests 847 € abbex human
DL-WIF1-Hu Human WNT Inhibitory Factor 1 WIF1 ELISA Kit 96T 974 € DL elisas human
CH27 Recombinant Mouse Macrophage Migration Inhibitory Factor, MIF (C-6His) 1 mg 2283 € novo mouse
abx130317 Anti-WNT Inhibitory Factor 1 Antibody 50 μg 456 € abbex human
AE11192MO-48 ELISA test for Mouse Wnt inhibitory factor 1 (WIF1) 1x plate of 48 wells 373 € abebio mouse
AE11192MO-96 Mouse Wnt inhibitory factor 1 (WIF1) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
GENTAUR-58bdb5c984d38 Rat Wnt inhibitory factor 1 (Wif1) 100ug 2000 € MBS Recombinant Proteins rat
GENTAUR-58bdb5c9e821d Rat Wnt inhibitory factor 1 (Wif1) 1000ug 2000 € MBS Recombinant Proteins rat
GENTAUR-58bdb5ca4ca1a Rat Wnt inhibitory factor 1 (Wif1) 100ug 2514 € MBS Recombinant Proteins rat
GENTAUR-58bdb5caa0b2c Rat Wnt inhibitory factor 1 (Wif1) 1000ug 2514 € MBS Recombinant Proteins rat
EKU08223 WNT Inhibitory Factor 1 (WIF1) ELISA kit 1 plate of 96 wells 899 € Biomatik ELISA kits human
SP-101812-1 [Tyr0] Gastric Inhibitory Peptide (23-42), human; [Tyr22] Gastric Inhibitory Peptide (22-42), human [Tyr-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln; MW 2584.9] 1 mg 188 € adi human
CE69 Recombinant Human MAP3K12-Binding Inhibitory Protein 1, MBIPP (N-6His) 500 µg 1613 € novo human
C150 Recombinant Human Melanoma Inhibitory Activity Protein, MIA (C-6His) 1 mg 2283 € novo human
MBS618165 JIK (JNK/SAPK-inhibitory Kinase, Jun Kinase Inhibitory Kinase, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, CTCL-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, DPK, KDS, Kinase from Chicken Homolog A, hKFC-A, MAP3K18, Serine Antibody 100ug 735 € MBS Polyclonals_1 chicken
GENTAUR-58b8ddf6c1105 Alopias vulpinus Protein Wnt-10a (WNT-10A) 100ug 1420 € MBS Recombinant Proteins human
GENTAUR-58b8ddf732f5e Alopias vulpinus Protein Wnt-10a (WNT-10A) 1000ug 1420 € MBS Recombinant Proteins human