Recombinant Human Vitronectin, VTN (C-6His)

Contact us
Catalog number: C395
Price: 348 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Vitronectin, VTN (C-6His)
Quantity: 0.12 ml
Other quantities: 1 mg 659€ 10 µg 80€ 500 µg 476€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Vitronectin is produced by our Mammalian expression system and the target gene encoding Asp20-Leu478 is expressed with a 6His tag at the C-terminus
Molecular Weight: 35 kD, 53
UniProt number: P04004
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRAMWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHLVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: VTN (C-6His), Vitronectin
Short name: VTN (C-6His), Recombinant Vitronectin
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: VTN (C-6His), sapiens Vitronectin, recombinant H
Alternative technique: rec
Identity: 12724
Gene: VTN | More about : VTN
Long gene name: vitronectin
Synonyms gene name: complement S-protein) , somatomedin B, vitronectin (serum spreading factor
Synonyms: VN
Synonyms name: serum spreading factor somatomedin B complement S-protein
Locus: 17q11, 2
Discovery year: 1992-07-30
GenBank acession: BC005046
Entrez gene record: 7448
Pubmed identfication: 2447940
RefSeq identity: NM_000638
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000132500

Related Products :

C395 Recombinant Human Vitronectin, VTN (C-6His) 1 mg 659 € novo human
CG99 Recombinant Human Vitronectin, VTN-N (Val62-Leu478) 10 µg 75 € novo human
RP-1595M Recombinant Mouse Vitronectin / VTN Protein (His Tag) 50μg 346 € adv mouse
abx575196 Anti-Human Vitronectin (VTN) ELISA Kit inquire 50 € abbex human
AE57142HU-48 ELISA test for Human Vitronectin (VTN) 1x plate of 48 wells 402 € abebio human
AE57142HU Human Vitronectin (VTN) ELISA Kit 96 wells plate 810 € ab-elisa elisas human
AE57142HU-96 Human Vitronectin (VTN) ELISA Kit 1x plate of 96 wells 671 € abebio human
DL-VTN-Hu Human Vitronectin VTN ELISA Kit 96T 869 € DL elisas human
GENTAUR-58bde6f9000b5 Mouse Monoclonal (IgG1,k) to Human VTN / Vitronectin Antibody 0.05 ml 597 € MBS mono human
abx574031 Anti-Mouse Vitronectin (VTN) ELISA Kit 96 tests 775 € abbex mouse
abx576118 Anti-Rat Vitronectin (VTN) ELISA Kit 96 tests 804 € abbex rat
GENTAUR-58bdc1fe68f05 Anti- Vitronectin (VTN) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdc1ff2fe46 Anti- Vitronectin (VTN) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdc6f874082 Anti- Vitronectin (VTN) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdc6f8d3ad0 Anti- Vitronectin (VTN) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdcc5a23b03 Anti- Vitronectin (VTN) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdce986ee14 Anti- Vitronectin (VTN) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdce98cabc3 Anti- Vitronectin (VTN) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdd1a1ba52a Anti- Vitronectin (VTN) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdd2815af10 Anti- Vitronectin (VTN) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdd8f110695 Anti- Vitronectin (VTN) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd9be0ca36 Anti- Vitronectin (VTN) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bddc9094c2a Anti- Vitronectin (VTN) Antibody 100ug 542 € MBS Polyclonals human
DL-VTN-Mu Mouse Vitronectin VTN ELISA Kit 96T 904 € DL elisas mouse
DL-VTN-Ra Rat Vitronectin VTN ELISA Kit 96T 962 € DL elisas rat
EKU08172 Vitronectin (VTN) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU08173 Vitronectin (VTN) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
EKU08174 Vitronectin (VTN) ELISA kit 1 plate of 96 wells 846 € Biomatik ELISA kits human
LV356441 VTN Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bdf00ce4c3e Anti- VTN Antibody 0.12 ml 348 € MBS Polyclonals human