| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Osteonectin is produced by our Mammalian expression system and the target gene encoding Ala18-Ile303 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
33, 73 kD |
| UniProt number: |
P09486 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVIVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
BM-40 (C-6His), SPARC, Osteonectin |
| Short name: |
BM-40 (C-6His), SPARC, Recombinant Osteonectin |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
BM-40 (C-6His), acidic, cysteine-rich (osteonectin), sapiens Osteonectin, secreted protein, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
ON, SPARC and IDBG-54562 and ENSG00000113140 and 6678, SPARC and IDBG-646341 and ENSBTAG00000014835 and 282077, Sparc and IDBG-175174 and ENSMUSG00000018593 and 20692, acidic, cysteine-rich (osteonectin), extracellular matrix binding, nuclei, this GO :0001503 and ossification and biological process this GO :0002576 and platelet degranulation and biological process this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005518 and collagen binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005578 and proteinaceous extracellular matrix and cellular component this GO :0005604 and basement membrane and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0007165 and signal transduction and biological process this GO :0007507 and heart development and biological process this GO :0007596 and blood coagulation and biological process this GO :0009629 and response to gravity and biological process this GO :0010288 and response to lead ion and biological process this GO :0030168 and platelet activation and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030324 and lung development and biological process this GO :0031012 and extracellular matrix and cellular component this GO :0031093 and platelet alpha granule lumen and cellular component this GO :0031988 and membrane-bounded vesicle and cellular component this GO :0032496 and response to lipopolysaccharide and biological process this GO :0033591 and response to L-ascorbic acid and biological process this GO :0034097 and response to cytokine and biological process this GO :0042060 and wound healing and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0043434 and response to peptide hormone and biological process this GO :0045471 and response to ethanol and biological process this GO :0046686 and response to cadmium ion and biological process this GO :0048839 and inner ear development and biological process this GO :0050840 and extracellular matrix binding and molecular function this GO :0051384 and response to glucocorticoid and biological process this GO :0051591 and response to cAMP and biological process this GO :0051592 and response to calcium ion and biological process this GO :0060348 and bone development and biological process this GO :0071363 and cellular response to growth factor stimulus and biological process this GO :0071682 and endocytic vesicle lumen and cellular component, this GO :0005509 : calcium ion binding, this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0005518 : collagen binding and also this GO :0050840 : extracellular matrix binding, this GO :0005515 : protein binding, this GO :0005518 : collagen binding, this GO :0050840 : extracellular matrix binding, secreted protein |
| Identity: |
11219 |
| Gene: |
SPARC |
More about : SPARC |
| Long gene name: |
secreted protein acidic and cysteine rich |
| Synonyms gene: |
ON |
| Synonyms gene name: |
osteonectin |
| Synonyms name: |
cysteine-rich protein secreted protein acidic and rich in cysteine |
| Locus: |
5q33, 1 |
| Discovery year: |
2001-06-22 |
| Entrez gene record: |
6678 |
| Pubmed identfication: |
2838412 3410046 |
| RefSeq identity: |
NM_003118 |
| Classification: |
SPARC family |
| Havana BLAST/BLAT: |
OTTHUMG00000130122 |