Recombinant Human Tryptase epsilon, Brain-Specific Serine Protease 4, BSSP-4 (C-6His)

Contact us
Catalog number: C383
Price: 603 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Tryptase epsilon, Brain-Specific Serine Protease 4, BSSP-4 (C-6His)
Quantity: 200ul
Other quantities: 1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Tryptase epsilon is produced by our Mammalian expression system and the target gene encoding Ala33-Ser317 is expressed with a 6His tag at the C-terminus
Molecular Weight: 31, 56 kD
UniProt number: Q9GZN4
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10% Glycerol, 150 mM sodium chloride, pH 4, 2 um filtered solution of 20 mM HAc-NaAc, 5, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVYSWKEGACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHRSWVEKIVQGVQLRGRAQGGGALRAPSQGSGAAARSHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: BSSP-4 (C-6His), Brain-Specific Serine Protease 4, Tryptase epsilon
Short name: BSSP-4 (C-6His), Brain-Specific Serine Protease 4, Recombinant Tryptase epsilon
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: BSSP-4 (C-6His), Brain-Specific Serine Protease 4, sapiens Tryptase epsilon, recombinant H
Alternative technique: rec
Identity: 14368
Gene: PRSS22 | More about : PRSS22
Long gene name: protease, serine 22
Synonyms: hBSSP-4 BSSP-4 SP001LA
Synonyms name: brain-specific serine protease 4
Locus: 16p13, 3
Discovery year: 2001-09-26
GenBank acession: AF321182
Entrez gene record: 64063
Pubmed identfication: 11602603 15701722
RefSeq identity: NM_022119
Classification: Proteases, serine
Havana BLAST/BLAT: OTTHUMG00000128961

Related Products :

C383 Recombinant Human Tryptase epsilon, Brain-Specific Serine Protease 4, BSSP-4 (C-6His) 1 mg 2283 € novo human
MBS621351 Casein Kinase 1 epsilon (Casein Kinase I epsilon, Casein Kinase I Isoform epsilon, CKI epsilon, CKIe, CK1 epsilon, CSNK1E, HCKIE, KC1E, Kinase CK1 epsilon, MGC10398) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS623159 USP18 (Ubiquitin Specific Protease 18, Ubiquitin-specific Protease 18, 43kD ISG15-specific Protease, ISG43, hUBP43, ISG15-specific-processing Protease, Ubl Carboxyl-terminal Hydrolase 18, Ubl Thioesterase 18) 100ug 829 € MBS Polyclonals_1 human
MBS624565 SENP3, NT (Sentrin-specific Protease 3, Sentrin/SUMO-specific Protease SENP3, SUMO-1 Specific Protease 3, SSP3, SUSP3) 200ul 603 € MBS Polyclonals_1 human
MBS623950 SENP6, NT (SUSP1, Sentrin-specific Protease 6, Sentrin/SUMO-specific Protease SENP6, SUMO-1-specific Protease 1, KIAA0797, SSP1, FKSG6) Antibody 200ul 597 € MBS Polyclonals_1 human
MBS623942 SENP7, CT (Sentrin-specific Protease 7, Sentrin/SUMO-specific Protease SENP7, SUMO-1-specific Protease 2, SENP7, KIAA1707, SSP2, SUSP2) Antibody 200ul 603 € MBS Polyclonals_1 human
CP82 Recombinant Human Tryptase alpha, beta-1, TPSAB1 (C-6His) 50 µg 496 € novo human
C505 Recombinant Human Tryptase β-2, TPSB2 (C-6His) 500 µg 1613 € novo human
C165 Recombinant Human Protein Kinase C Type ε, PKC ε, PKCE (C-6His) 500 µg 1613 € novo human
C431 Recombinant Human Brain-Specific Angiogenesis Inhibitor 3, BAI3 (C-6His) 1 mg 2283 € novo human
MBS624528 SENP2, CT (Sentrin-specific Protease 2, Sentrin/SUMO-specific Protease SENP2, SMT3-Specific Isopeptidase 2, Smt3ip2, Axam2, KIAA1331) 200ul 603 € MBS Polyclonals_1 human
MBS621243 USP11 (Ubiquitin Specific Peptidase 11, Ubiquitin Specific Protease 11, Ubiquitin Specific-processing Protease 11, Deubiquitinating Enzyme 11, Ubiquitin Carboxyl-terminal Hydrolase X-linked, Ubiquitin Thiolesterase 11, UHX1) 100ug 735 € MBS Polyclonals_1 human
MBS620746 USP15 (Ubiquitin Specific Peptidase 15, Ubiquitin Specific-processing Protease 15, Ubiquitin Specific Protease 15, Deubiquitinating Enzyme 15, Deubiquitinating Enzyme, KIAA0529, MGC131982, MGC149838, MGC74854, Ubiquitin Carboxy Terminal Hydrolase 15, Ubiq 100ug 785 € MBS Polyclonals_1 human
MBS619808 USP24 (Ubiquitin Specific Peptidase 24, Ubiquitin Specific Protease 24, Ubiquitin Specific-processing Protease 24, Deubiquitinating Enzyme 24, KIAA1057, Ubiquitin Carboxyl Terminal Hydrolase 24, Ubiquitin Thioesterase 24) Antibody 100ug 785 € MBS Polyclonals_1 human
MBS620278 USP28 (Ubiquitin Specific Peptidase 28, Ubiquitin Specific Protease 28, Ubiquitin Specific-processing Protease 28, USP28 Protein, Deubiquitinating Enzyme 28, KIAA1515, Ubiquitin Carboxyl Terminal Hydrolase 28, Ubiquitin Thioesterase 28) Antibody 100ul 785 € MBS Polyclonals_1 human
MBS622901 USP38 (Ubiquitin Specific Peptidase 38, Ubiquitin Specific Protease 38, Ubiquitin Specific-processing Protease 38, Deubiquitinating Enzyme 38, KIAA1891, Ubiquitin Carboxyl Terminal Hydrolase 38, Ubiquitin Thioesterase 38) 100ug 785 € MBS Polyclonals_1 human
abx251658 Anti-Human Brain-specific serine protease 4 ELISA Kit 96 tests 659 € abbex human
C655 Recombinant Human Mannan-Binding Lectin Serine Protease 1, MASP1 (C-6His) 50 µg 496 € novo human
C760 Recombinant Human Serine Protease HTRA2, HTRA2, Omi (C-6His) 1 mg 1115 € novo human
CH01 Recombinant Human Sentrin-Specific Protease 2, SENP2 (N-6His, SUMO tag) 1 mg 1014 € novo human
C171 Recombinant Human Sentrin-Specific Protease 7, SENP7 (N-6His) 1 mg 2283 € novo human
C172 Recombinant Human Sentrin-Specific Protease 8, SENP8 (N-6His) 1 mg 405 € novo human
103-M499 Anti-Mouse Tryptase-epsilon 100ug 336 € Reliatech antibodies mouse
MBS624161 IKBE, phosphorylated (Ser22) (NFKBIE, NF-kappa-B Inhibitor epsilon, NF-kappa-BIE, I-kappa-B-epsilon, IkB-E, IkB-epsilon, IkappaBepsilon) Antibody 50ug 481 € MBS Polyclonals_1 human
C665 Recombinant Mouse Serine Protease Inhibitor A3N, Serpin A3N (C-6His) 1 mg 2486 € novo mouse
C154 Recombinant Human Brain Natriuretic Peptide, BNP (His27-His134, N-6His) 1 mg 2283 € novo human
CM29 Recombinant Human Brain Natriuretic Peptide, BNP (N-6His-Flag) 50 µg 369 € novo human
C578 Recombinant Human CD3 ε, CD3E (C-6His) 50 µg 369 € novo human
MBS624113 SRPK1, NT (Serine/Threonine-protein Kinase SRPK1, Serine/Arginine-rich Protein-specific Kinase 1, SR-protein-specific Kinase 1, SFRS Protein Kinase 1) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS624582 SRPK2, CT (Serine/Threonine-protein Kinase SRPK2, Serine/Arginine-rich Protein-specific Kinase 2, SR-protein-specific Kinase 2, SFRS Protein Kinase 2) Antibody 200ul 603 € MBS Polyclonals_1 human