Recombinant Human Kallikrein 7, KLK7, SCEE (C-6His

Contact us
Catalog number: C364
Price: 2283 €
Supplier: novo
Product name: Recombinant Human Kallikrein 7, KLK7, SCEE (C-6His
Quantity: 1 mg
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Kallikrein 7 is produced by our Mammalian expression system and the target gene encoding Glu23-His252 is expressed with a 6His tag at the C-terminus
Molecular Weight: 17 kD, 26
UniProt number: P49862
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM HEPES, 5, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: EEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPWGQPNDPGVYTQVCKFTKWINDTMKKHVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: KLK7, SCEE (C-6His, Kallikrein 7
Short name: KLK7, SCEE (C-6His, Recombinant Kallikrein 7
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: KLK7, SCEE (C-6His, sapiens Kallikrein 7, recombinant H
Alternative technique: rec
Identity: 6368
Gene: KLK7 | More about : KLK7
Long gene name: kallikrein related peptidase 7
Synonyms gene: PRSS6
Synonyms gene name: kallikrein 7 (chymotryptic, stratum corneum)
Synonyms: SCCE
Locus: 19q13, 33
Discovery year: 1995-06-14
GenBank acession: L33404
Entrez gene record: 5650
Pubmed identfication: 8034709 16800724 16800723
RefSeq identity: NM_005046
Classification: Kallikreins Proteases, serine
Havana BLAST/BLAT: OTTHUMG00000182917

Related Products :

C364 Recombinant Human Kallikrein 7, KLK7, SCEE (C-6His 1 mg 2283 € novo human
CK86 Recombinant Mouse Kallikrein 7, KLK7 (C-6His) 50 µg 496 € novo mouse
MBS619101 KLK1B27 (Klk1b27, kallikrein 1-related peptidase b27, Gk27, Klk27, mGK-27, glandular kallikrein 27, kallikrein 27) Antibody 100ug 509 € MBS Polyclonals_1 human
RP-1381M Recombinant Mouse KLK7 / Kallikrein 7 Protein (His Tag) 10μg 624 € adv mouse
abx570405 Anti-Human Kallikrein 7 (KLK7) ELISA Kit 96 tests 673 € abbex human
DL-KLK7-Hu Human Kallikrein 7 KLK7 ELISA Kit 96T 788 € DL elisas human
GENTAUR-58bdc2c83ccd6 Anti- Kallikrein 7 (KLK7) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc2c88e23d Anti- Kallikrein 7 (KLK7) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc4921e926 Anti- Kallikrein 7 (KLK7) Antibody 50ug 332 € MBS Polyclonals human
GENTAUR-58bdc49297c01 Anti- Kallikrein 7 (KLK7) Antibody 100ug 409 € MBS Polyclonals human
GENTAUR-58bdc4997b1c7 Anti- Kallikrein 7 (KLK7) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc499def82 Anti- Kallikrein 7 (KLK7) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc83b97322 Anti- Kallikrein 7 (KLK7) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc906b8aa5 Anti- Kallikrein 7 (KLK7) Antibody 100ug 442 € MBS Polyclonals human
GENTAUR-58bdcde6726d3 Anti- Kallikrein 7 (KLK7) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd4f8588be Anti- Kallikrein 7 (KLK7) Antibody 100ug 475 € MBS Polyclonals human
GENTAUR-58bdd7ca8a4dd Anti- Kallikrein 7 (KLK7) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddcc84771b Anti- Kallikrein 7 (KLK7) Antibody 100ug 580 € MBS Polyclonals human
AR50561PU-N anti-KLK7 / Kallikrein-7 (30-253, His-tag) Antibody 0,5 mg 1109 € acr human
AR50561PU-S anti-KLK7 / Kallikrein-7 (30-253, His-tag) Antibody 0,1 mg 485 € acr human
abx571173 Anti-Mouse Kallikrein 7 (KLK7) ELISA Kit inquire 50 € abbex mouse
EKU05449 Kallikrein 7 (KLK7) ELISA kit 1 plate of 96 wells 667 € Biomatik ELISA kits human
EKU05450 Kallikrein 7 (KLK7) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
DL-KLK7-Mu Mouse Kallikrein 7 KLK7 ELISA Kit 96T 904 € DL elisas mouse
C481 Recombinant Human Kallikrein 1, KLK1 (C-6His) 10 µg 202 € novo human
C360 Recombinant Human Kallikrein 10, KLK10 (C-6His) 50 µg 496 € novo human
C361 Recombinant Human Kallikrein 11, KLK11 (C-6His) 1 mg 2283 € novo human
C362 Recombinant Human Kallikrein 13, KLK13 (C-6His) 50 µg 496 € novo human
C616 Recombinant Human Kallikrein 2, KLK2 (C-6His) 50 µg 496 € novo human
C363 Recombinant Human Kallikrein 4, KLK4 (C-6His) 1 mg 2283 € novo human