Recombinant Human Kallikrein 10, KLK10 (C-6His)

Contact us
Catalog number: C360
Price: 470 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Kallikrein 10, KLK10 (C-6His)
Quantity: 1 mililiter
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Kallikrein 10 is produced by our Mammalian expression system and the target gene encoding Ala31-Asn276 is expressed with a 6His tag at the C-terminus
Molecular Weight: 27, 98 kD
UniProt number: O43240
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AEAALLPQNDTRLDPEAYGAPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVPGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSNVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: KLK10 (C-6His), Kallikrein 10
Short name: KLK10 (C-6His), Recombinant Kallikrein 10
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: KLK10 (C-6His), sapiens Kallikrein 10, recombinant H
Alternative technique: rec
Identity: 6358
Gene: KLK10 | More about : KLK10
Long gene name: kallikrein related peptidase 10
Synonyms gene: PRSSL1
Synonyms gene name: kallikrein 10
Synonyms: NES1
Locus: 19q13, 41
Discovery year: 1997-05-09
GenBank acession: AF024605
Entrez gene record: 5655
Pubmed identfication: 8764136 9533035 16800724 16800723 10675891
RefSeq identity: NM_002776
Classification: Kallikreins
Havana BLAST/BLAT: OTTHUMG00000182916

Related Products :

C360 Recombinant Human Kallikrein 10, KLK10 (C-6His) 50 µg 496 € novo human
MBS619101 KLK1B27 (Klk1b27, kallikrein 1-related peptidase b27, Gk27, Klk27, mGK-27, glandular kallikrein 27, kallikrein 27) Antibody 100ug 509 € MBS Polyclonals_1 human
abx574301 Anti-Human Kallikrein 10 (KLK10) ELISA Kit inquire 50 € abbex human
AE36494HU-48 ELISA test for Human Kallikrein 10 (KLK10) 1x plate of 48 wells 402 € abebio human
AE36494HU Human Kallikrein 10 (KLK10) ELISA Kit 96 wells plate 810 € ab-elisa elisas human
AE36494HU-96 Human Kallikrein 10 (KLK10) ELISA Kit 1x plate of 96 wells 671 € abebio human
DL-KLK10-Hu Human Kallikrein 10 KLK10 ELISA Kit 96T 672 € DL elisas human
GENTAUR-58bdc4ee08640 Anti- Kallikrein 10 (KLK10) Antibody 100ug 382 € MBS Polyclonals human
GENTAUR-58bdc73265c77 Anti- Kallikrein 10 (KLK10) Antibody 50ug 299 € MBS Polyclonals human
GENTAUR-58bdc732cce17 Anti- Kallikrein 10 (KLK10) Antibody 100ug 365 € MBS Polyclonals human
GENTAUR-58bdd8c31b2fd Anti- Kallikrein 10 (KLK10) Antibody 100ug 520 € MBS Polyclonals human
AR51484PU-N anti-KLK10 / Kallikrein-10 (34-276, His-tag) Antibody 0,5 mg 1109 € acr human
AR51484PU-S anti-KLK10 / Kallikrein-10 (34-276, His-tag) Antibody 0,1 mg 485 € acr human
BB-PA1821 anti-KLK10 / Kallikrein-10 Antibody 0,1 mg 471 € acr human
GT15096-100 anti-KLK10 / Kallikrein-10 Antibody 0,1 mg 703 € acr human
EKU05430 Kallikrein 10 (KLK10) ELISA kit 1 plate of 96 wells 557 € Biomatik ELISA kits human
C481 Recombinant Human Kallikrein 1, KLK1 (C-6His) 10 µg 202 € novo human
C361 Recombinant Human Kallikrein 11, KLK11 (C-6His) 1 mg 2283 € novo human
C362 Recombinant Human Kallikrein 13, KLK13 (C-6His) 50 µg 496 € novo human
C616 Recombinant Human Kallikrein 2, KLK2 (C-6His) 50 µg 496 € novo human
C363 Recombinant Human Kallikrein 4, KLK4 (C-6His) 1 mg 2283 € novo human
C415 Recombinant Human Kallikrein 5, KLK5 (C-6His) 50 µg 496 € novo human
C366 Recombinant Human Kallikrein 6, KLK6, Neurosin (C-6His) 10 µg 202 € novo human
C364 Recombinant Human Kallikrein 7, KLK7, SCEE (C-6His 1 mg 2283 € novo human
C367 Recombinant Human Kallikrein 8, Neuropsin (C-6His) 1 mg 2283 € novo human
CJ20 Recombinant Human Plasma Kallikrein, KLKB1 (C-6His) 500 µg 1613 € novo human
CK86 Recombinant Mouse Kallikrein 7, KLK7 (C-6His) 50 µg 496 € novo mouse
MBS610873 Prostate Speci?c Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) 1 mililiter 470 € MBS Polyclonals_1 human
MBS612293 Prostate Speci?c Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) 1000ug 641 € MBS Polyclonals_1 human
MBS618778 Prostate Speci?c Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) Antibody 1 mililiter 470 € MBS Polyclonals_1 human