Recombinant Human Junctional Adhesion Molecule B, JAM-B, CD322 (C-6His)

Contact us
Catalog number: C359
Price: 671 €
Supplier: abebio
Product name: Recombinant Human Junctional Adhesion Molecule B, JAM-B, CD322 (C-6His)
Quantity: 1x plate of 96 wells
Other quantities: 1 mg 2283€ 50 µg 263€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: present in lysates used as reference for ELISA quantification of these molecules and their subunits, Whole adhesion and interacting molecules are 
Molecular Weight: 24, 29 kD
UniProt number: P57087
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD322 (C-6His), JAM-B, Junctional Adhesion Molecule B
Short name: CD322 (C-6His), JAM-B, Recombinant Junctional Adhesion Molecule B
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD322 (C-6His), JAM-B, sapiens Junctional Adhesion Molecule B, recombinant H
Alternative technique: rec
Identity: 14686
Gene: JAM2 | More about : JAM2
Long gene name: junctional adhesion molecule 2
Synonyms gene: C21orf43
Synonyms: VE-JAM JAM-B JAMB CD322
Locus: 21q21, 3
Discovery year: 2001-04-25
GenBank acession: AF255910
Entrez gene record: 58494
Pubmed identfication: 10779521 10945976
Classification: I-set domain containing CD molecules V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000078441

Related Products :

C359 Recombinant Human Junctional Adhesion Molecule B, JAM-B, CD322 (C-6His) 50 µg 263 € novo human
CC52 Recombinant Human Junctional Adhesion Molecule B, JAM-B, CD322 (C-Fc) 500 µg 1613 € novo human
C468 Recombinant Human Junctional Adhesion Molecule A, JAM-A, CD321 (C-6His) 50 µg 369 € novo human
101-M525 Anti-Human Junctional adhesion molecule B (JAM-B) 100ug 336 € Reliatech antibodies human
101-M526 Anti-Human Junctional adhesion molecule C (JAM-C) 100ug 336 € Reliatech antibodies human
103-M257 Anti-Mouse Junctional adhesion molecule A (JAM-A) 100ug 336 € Reliatech antibodies mouse
103-M258 Anti-Mouse Junctional adhesion molecule B (JAM-B) 100ug 336 € Reliatech antibodies mouse
GWB-997FA3 JUNCTIONAL ADHESION MOLECULE-A (JAM-A), antibody 1 vial 775 € genways human
GWB-BA8520 JUNCTIONAL ADHESION MOLECULE-A (JAM-A), antibody 1 vial 775 € genways human
GWB-C1E202 JUNCTIONAL ADHESION MOLECULE-A (JAM-A), antibody 1 vial 775 € genways human
MBS540640 Junctional Adhesion Molecule A (Jam A0) antibodies Antibody 200ul FITC 597 € MBS Polyclonals_1 human
GWB-3B5D00 JUNCTIONAL ADHESION MOLECULE-C (JAM-C), antibody 1 x 1 vial 775 € genways human
GWB-EEBD40 JUNCTIONAL ADHESION MOLECULE-C (JAM-C), antibody 1 vial 775 € genways human
RP-1373M Recombinant Mouse JAM2 / CD322 / VE-JAM Protein (His Tag) 50μg 624 € adv mouse
abx168264 Anti-Junctional Adhesion Molecule 1 Protein (Recombinant) 50 μg 615 € abbex human
abx166507 Anti-Junctional Adhesion Molecule 2 Protein (Recombinant) 100 μg 804 € abbex human
abx261003 Anti-Junctional Adhesion Molecule 2 Protein (Recombinant) 20 µg 340 € abbex human
abx168383 Anti-Junctional Adhesion Molecule 3 Protein (Recombinant) 100 μg 862 € abbex human
abx263308 Anti-Junctional Adhesion Molecule 3 Protein (Recombinant) 2 µg 238 € abbex human
DL-JAM1-Hu Human Junctional Adhesion Molecule 1 JAM1 ELISA Kit 96T 869 € DL elisas human
DL-JAM2-Hu Human Junctional Adhesion Molecule 2 JAM2 ELISA Kit 96T 846 € DL elisas human
DL-JAM3-Hu Human Junctional Adhesion Molecule 3 JAM3 ELISA Kit 96T 974 € DL elisas human
JAMA-101AP anti-Junctional Adhesion Molecule 1 Antibody 100 µg 357 € fabgen human
abx128588 Anti-Junctional Adhesion Molecule 1 Antibody 50 μg 398 € abbex human
JAMA-BIOTIN anti-Junctional Adhesion Molecule 1 Antibody BIOTIN 100 µg 456 € fabgen human
JAMA-FITC anti-Junctional Adhesion Molecule 1 Antibody FITC 100 µg 456 € fabgen human
abx128023 Anti-Junctional Adhesion Molecule 2 Antibody 10 μg 267 € abbex human
abx129330 Anti-Junctional Adhesion Molecule 3 Antibody 10 μg 282 € abbex human
AE44969CA Cat Junctional adhesion molecule A (F11R) ELISA Kit 48 wells plate 500 € ab-elisa elisas cat
AE44969CA-96 Cat Junctional adhesion molecule A (F11R) ELISA Kit 1x plate of 96 wells 671 € abebio cat