Recombinant Human EpCAM, TROP1, CD326 (C-6His)

Contact us
Catalog number: C339
Price: 572 €
Supplier: acr
Product name: Recombinant Human EpCAM, TROP1, CD326 (C-6His)
Quantity: 1,0 ml
Other quantities: 1 mg 2283€ 50 µg 263€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human EpCAM is produced by our Mammalian expression system and the target gene encoding Gln24-Lys265 is expressed with a 6His tag at the C-terminus
Molecular Weight: 28, 43 kD
UniProt number: P16422
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD326 (C-6His), TROP1, EpCAM
Short name: CD326 (C-6His), TROP1, Recombinant EpCAM
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD326 (C-6His), TROP1, sapiens epithelial cellular adhesion molecule, recombinant H
Alternative technique: rec
Identity: 11529
Gene: EPCAM | More about : EPCAM
Long gene name: epithelial cell adhesion molecule
Synonyms gene: M4S1 MIC18 TACSTD1
Synonyms gene name: antigen identified by monoclonal antibody AUA1 tumor-associated calcium signal transducer 1
Synonyms: Ly74 TROP1 GA733-2 EGP34 EGP40 EGP-2 KSA CD326 Ep-CAM HEA125 KS1/4 MK-1 MH99 MOC31 323/A3 17-1A TACST-1 CO-17A ESA
Locus: 2p21
Discovery year: 1995-10-02
GenBank acession: M33011
Entrez gene record: 4072
Pubmed identfication: 8382772 11306819
Classification: CD molecules
Havana BLAST/BLAT: OTTHUMG00000128853
Locus Specific Databases: Colon cancer gene variant databases LRG_215

Related Products :

C339 Recombinant Human EpCAM, TROP1, CD326 (C-6His) 500 µg 1613 € novo human
CM50 Recombinant Human EpCAM, TROP1, CD326 (C-Fc) 1 mg 1877 € novo human
MBS423211 Goat anti-EPCAM / TROP1 (aa167-179) Antibody 100ug 370 € MBS Polyclonals_1 human
AR50669PU-N anti-CD326 / EPCAM / TACSTD1 (24-265, His-tag) Antibody 0,5 mg 1109 € acr human
AR50669PU-S anti-CD326 / EPCAM / TACSTD1 (24-265, His-tag) Antibody 0,1 mg 485 € acr human
AM06447SU-N anti-CD326 / EPCAM / TACSTD1 Antibody 0,1 ml 630 € acr human
AM10033FC-N anti-CD326 / EPCAM / TACSTD1 Antibody 0,2 mg 616 € acr human
AM10033FC-S anti-CD326 / EPCAM / TACSTD1 Antibody 0,1 mg 485 € acr human
AM10033PU-N anti-CD326 / EPCAM / TACSTD1 Antibody 1 ml 572 € acr human
AM10033PU-S anti-CD326 / EPCAM / TACSTD1 Antibody 0,5 ml 442 € acr human
AM11133PU-M anti-CD326 / EPCAM / TACSTD1 Antibody 0,5 ml 572 € acr human
AM11133PU-N anti-CD326 / EPCAM / TACSTD1 Antibody 1 ml 775 € acr human
AM11133PU-S anti-CD326 / EPCAM / TACSTD1 Antibody 0,1 ml 326 € acr human
AM26013PU-N anti-CD326 / EPCAM / TACSTD1 Antibody 0,1 mg 355 € acr human
AM32818SU-L anti-CD326 / EPCAM / TACSTD1 Antibody 1,0 ml 572 € acr human
AM32818SU-N anti-CD326 / EPCAM / TACSTD1 Antibody 0,5 ml 471 € acr human
AM32818SU-S anti-CD326 / EPCAM / TACSTD1 Antibody 0,1 ml 268 € acr human
AM32819SU-L anti-CD326 / EPCAM / TACSTD1 Antibody 1,0 ml 572 € acr human
AM32819SU-N anti-CD326 / EPCAM / TACSTD1 Antibody 0,5 ml 471 € acr human
AM32819SU-S anti-CD326 / EPCAM / TACSTD1 Antibody 0,1 ml 268 € acr human
AM33039PU-N anti-CD326 / EPCAM / TACSTD1 Antibody 0,1 mg 543 € acr human
AM33194PU-N anti-CD326 / EPCAM / TACSTD1 Antibody 1 ml 1413 € acr human
AM33194PU-S anti-CD326 / EPCAM / TACSTD1 Antibody 0,1 ml 601 € acr human
AM33243AC-S anti-CD326 / EPCAM / TACSTD1 Antibody 100 Tests 471 € acr human
AM33243PU-N anti-CD326 / EPCAM / TACSTD1 Antibody 0,2 mg 616 € acr human
AM33243PU-S anti-CD326 / EPCAM / TACSTD1 Antibody 0,1 mg 514 € acr human
AM33243PU-T anti-CD326 / EPCAM / TACSTD1 Antibody 20 Вµg 282 € acr human
AM33243RP-N anti-CD326 / EPCAM / TACSTD1 Antibody 100 Tests 514 € acr human
AM33243RP-S anti-CD326 / EPCAM / TACSTD1 Antibody 25 Tests 326 € acr human
AM33247SU-L anti-CD326 / EPCAM / TACSTD1 Antibody 1,0 ml 572 € acr human