| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Osteoprotegerin is produced by our Mammalian expression system and the target gene encoding Glu22-Leu401 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
44, 65 kD |
| UniProt number: |
O00300 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCLVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
OPG, TNFRSF11B (C-6His), Osteoprotegerin |
| Short name: |
OPG, TNFRSF11B (C-6His), Recombinant Osteoprotegerin |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
OPG, member 11b (C-6His), sapiens Osteoprotegerin, tumor necrosis factor receptor superfamily, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, OCIF and OPG and TR1, TNFRSF11B and IDBG-33675 and ENSG00000164761 and 4982, TNFRSF11B and IDBG-644876 and ENSBTAG00000007423 and 523822, Tnfrsf11b and IDBG-140472 and ENSMUSG00000063727 and 18383, member 11b, protein binding, this GO :0001501 and skeletal system development and biological process this GO :0004872 and receptor activity and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005578 and proteinaceous extracellular matrix and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006915 and apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0007584 and response to nutrient and biological process this GO :0010035 and response to inorganic substance and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0032026 and response to magnesium ion and biological process this GO :0042489 and negative regulation of odontogenesis of dentin-containing tooth and biological process this GO :0042493 and response to drug and biological process this GO :0043627 and response to estrogen and biological process this GO :0045779 and negative regulation of bone resorption and biological process this GO :0046685 and response to arsenic-containing substance and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005125 : cytokine activity and also this GO :0005515 : protein binding, this GO :0005125 : cytokine activity, this GO :0005515 : protein binding, tumor necrosis factor receptor superfamily |
| Identity: |
11909 |
| Gene: |
TNFRSF11B |
More about : TNFRSF11B |
| Long gene name: |
TNF receptor superfamily member 11b |
| Synonyms gene: |
OPG |
| Synonyms gene name: |
member 11b , osteoprotegerin tumor necrosis factor receptor superfamily |
| Synonyms: |
OCIF TR1 |
| Locus: |
8q24, 12 |
| Discovery year: |
1997-09-05 |
| GenBank acession: |
U94332 |
| Entrez gene record: |
4982 |
| Pubmed identfication: |
9108485 |
| Classification: |
Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000164969 |