Recombinant Human CD55, DAF (C-6His)

Contact us
Catalog number: C323
Price: 543 €
Supplier: acr
Product name: Recombinant Human CD55, DAF (C-6His)
Quantity: 0,1 mg
Other quantities: 1 mg 2283€ 10 µg 131€ 50 µg 273€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CD55 is produced by our Mammalian expression system and the target gene encoding Asp35-Ser353 is expressed with a 6His tag at the C-terminus
Molecular Weight: 36 kD
UniProt number: P08174
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: DAF (C-6His), CD55
Short name: DAF (C-6His), Recombinant CD55
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: DAF (C-6His), decay accelerating factor to measure complement (Cromer blood group), sapiens CD55 molecule, recombinant H
Alternative technique: rec
Alternative to gene target: CD55 and IDBG-106331 and ENSG00000196352 and 1604, CD55 and IDBG-629269 and ENSBTAG00000006984 and 518609, CR and CROM and DAF and TC, Extracellular, alpha-beta T cell activation and biological process this GO :2000563 and positive regulation of CD4-positive, alpha-beta T cell cytokine production and biological process this GO :0043086 and negative regulation of catalytic activity and biological process this GO :0043434 and response to peptide hormone and biological process this GO :0045087 and innate immune response and biological process this GO :0045121 and membrane raft and cellular component this GO :0045730 and respiratory burst and biological process this GO :0045916 and negative regulation of complement activation and biological process this GO :0060137 and maternal process involved in parturition and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :2000516 and positive regulation of CD4-positive, alpha-beta T cell proliferation and biological process, classical pathway and biological process this GO :0007204 and positive regulation of cytosolic calcium ion concentration and biological process this GO :0007283 and spermatogenesis and biological process this GO :0008289 and lipid binding and molecular function this GO :0009615 and response to virus and biological process this GO :0009986 and cell surface and cellular component this GO :0016324 and apical plasma membrane and cellular component this GO :0030449 and regulation of complement activation and biological process this GO :0031225 and anchored component of membrane and cellular component this GO :0031664 and regulation of lipopolysaccharide-mediated signaling pathway and biological process this GO :0035743 and CD4-positive, decay accelerating factor for complement (Cromer blood group), lipid binding, this GO :0001618 and virus receptor activity and molecular function this GO :0004857 and enzyme inhibitor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006958 and complement activation, this GO :0001618 : virus receptor activity, this GO :0001618 : virus receptor activity and also this GO :0004857 : enzyme inhibitor activity and also this GO :0005515 : protein binding and also this GO :0008289 : lipid binding, this GO :0004857 : enzyme inhibitor activity, this GO :0005515 : protein binding, this GO :0008289 : lipid binding, CD55 molecule
Identity: 2665
Gene: CD55 | More about : CD55
Long gene name: CD55 molecule (Cromer blood group)
Synonyms gene: DAF
Synonyms gene name: Cromer blood group system) CD55 molecule, decay accelerating factor for complement (CD55, decay accelerating factor for complement (Cromer blood group)
Synonyms: CR TC CROM
Locus: 1q32, 2
Discovery year: 2001-06-22
GenBank acession: BC001288
Entrez gene record: 1604
RefSeq identity: NM_000574
Classification: Sushi domain containing CD molecules Blood group antigens
Havana BLAST/BLAT: OTTHUMG00000036255
Locus Specific Databases: Blood Group Antigen Mutation Database CD55base: Mutation registry for Decay-accelerating factor (CD55) deficiency (previously known as DAFbase) LRG_127

Related Products :

C323 Recombinant Human CD55, DAF (C-6His) 500 µg 1613 € novo human
RP-0349H Recombinant Human CD55 / DAF Protein (Fc Tag) 50μg 624 € adv human
RP-0348H Recombinant Human CD55 / DAF Protein (His Tag) 50μg 624 € adv human
RP-1144M Recombinant Mouse CD55 / DAF Protein (His Tag) 50μg 624 € adv mouse
RP-2062R Recombinant Rat CD55 / DAF Protein (Fc Tag) 50μg 624 € adv rat
GENTAUR-58bccf9d0ad8d Cell surface receptor daf-1 (daf-1) 100ug 1498 € MBS Recombinant Proteins human
GENTAUR-58bccf9d58091 Cell surface receptor daf-1 (daf-1) 1000ug 1498 € MBS Recombinant Proteins human
GENTAUR-58bccf9d91c53 Cell surface receptor daf-1 (daf-1) 100ug 2000 € MBS Recombinant Proteins human
GENTAUR-58bccf9dd97a2 Cell surface receptor daf-1 (daf-1) 1000ug 2000 € MBS Recombinant Proteins human
GENTAUR-58bc7e4601ae4 Cell surface receptor daf-4 (daf-4) 100ug 1630 € MBS Recombinant Proteins human
GENTAUR-58bc7e464702c Cell surface receptor daf-4 (daf-4) 1000ug 1630 € MBS Recombinant Proteins human
GENTAUR-58bc7e468ffd7 Cell surface receptor daf-4 (daf-4) 100ug 2144 € MBS Recombinant Proteins human
GENTAUR-58bc7e46da233 Cell surface receptor daf-4 (daf-4) 1000ug 2144 € MBS Recombinant Proteins human
MBS613329 DAF-3 (Abnormal Dauer Formation Protein 3, DAF 3) Antibody 100ul 597 € MBS Polyclonals_1 human
GENTAUR-58bc1c1652656 Dauer larva development regulatory growth factor daf-7 (daf-7) 100ug 1409 € MBS Recombinant Proteins human
GENTAUR-58bc1c169fd67 Dauer larva development regulatory growth factor daf-7 (daf-7) 1000ug 1409 € MBS Recombinant Proteins human
GENTAUR-58bc1c16e8573 Dauer larva development regulatory growth factor daf-7 (daf-7) 100ug 1912 € MBS Recombinant Proteins human
GENTAUR-58bc1c172f25f Dauer larva development regulatory growth factor daf-7 (daf-7) 1000ug 1912 € MBS Recombinant Proteins human
BMDV3237 Complement Regulatory Protein, CD55, Decay Accelerating Factor (DAF), 70kD, Clone: BRIC110, Mouse Monoclonal antibody-Human 500ul 648 € accurate-monoclonals human
OBT3248G Decay Accelarating Factor (DAF), CD55, Hematopoitic & non-hemat. Cell, Clone: BRIC-216, Mouse Monoclonal antibody-Human 0.1 mg Ask price € accurate-monoclonals human
AR52064PU-N anti-CD55 / DAF (35-362, His-tag) Antibody 0,25 mg 1413 € acr human
AR52064PU-S anti-CD55 / DAF (35-362, His-tag) Antibody 50 Вµg 485 € acr human
AM08162BT-N anti-CD55 / DAF Antibody 100 Tests 427 € acr human
AM08162FC-N anti-CD55 / DAF Antibody 100 Tests 456 € acr human
AM08162PU-N anti-CD55 / DAF Antibody 0,1 mg 326 € acr human
AM08162RP-N anti-CD55 / DAF Antibody 100 Tests 514 € acr human
AM08312PU-N anti-CD55 / DAF Antibody 50 Вµg 732 € acr human
AM26246FC-N anti-CD55 / DAF Antibody 0,1 mg 761 € acr human
AM26246PU-N anti-CD55 / DAF Antibody 0,1 mg 616 € acr human
AM26550AF-N anti-CD55 / DAF Antibody 0,1 mg 543 € acr human