| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Inhibin beta C Chain is produced by our E, coli expression system and the target gene encoding Gly237-Ser352 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
14, 83 kD |
| UniProt number: |
P55103 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
1 mM DTT, 2 um filtered solution of 4 mM HCl, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMGIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
C Chain, INHBC (N-6His), Inhibin &beta |
| Short name: |
C Chain, INHBC (N-6His), Recombinant Inhibin &beta |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
C epitope, b C (N-6His), inhibin, sapiens Inhibin &beta, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, IHBC, INHBC and IDBG-42549 and ENSG00000175189 and 3626, INHBC and IDBG-635276 and ENSBTAG00000019084 and 530785, Inhbc and IDBG-195100 and ENSMUSG00000025405 and 16325, beta C, growth factor activity, this GO :0005160 and transforming growth factor beta receptor binding and molecular function this GO :0005179 and hormone activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0008083 and growth factor activity and molecular function this GO :0040007 and growth and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005160 : transforming growth factor beta receptor binding, this GO :0005160 : transforming growth factor beta receptor binding and also this GO :0005179 : hormone activity and also this GO :0008083 : growth factor activity, this GO :0005179 : hormone activity, this GO :0008083 : growth factor activity, inhibin |
| Identity: |
6068 |
| Gene: |
INHBC |
More about : INHBC |
| Long gene name: |
inhibin beta C subunit |
| Synonyms gene name: |
beta C , inhibin |
| Locus: |
12q13, 3 |
| Discovery year: |
1995-08-29 |
| Entrez gene record: |
3626 |
| Pubmed identfication: |
7826378 |
| RefSeq identity: |
NM_005538 |
| Havana BLAST/BLAT: |
OTTHUMG00000169994 |