Recombinant Human HGPRT, HPRT1 (N-6His)

Contact us
Catalog number: C294
Price: 1022 €
Supplier: acr
Product name: Recombinant Human HGPRT, HPRT1 (N-6His)
Quantity: 0,5 mg
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human HGPRT is produced by our E, coli expression system and the target gene encoding Met1-Ala218 is expressed with a 6His tag at the N-terminus
Molecular Weight: 27, 79 kD
UniProt number: P00492
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 2 mM EDTA, 250 mM sodium chloride, 30% Glycerol, pH 8, 2 um filtered solution of 20 mM Tris, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKAVEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: HPRT1 (N-6His), HGPRT
Short name: HPRT1 (N-6His), Recombinant HGPRT
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: hypoxanthine phosphoribosyltransferase 1 (N-6His), sapiens HGPRT, recombinant H
Alternative technique: rec
Alternative to gene target: Cytoplasm, HGPRT and HPRT, HPRT1 and IDBG-86864 and ENSG00000165704 and 3251, Hprt and IDBG-145409 and ENSMUSG00000025630 and 15452, LOC510369 and IDBG-640500 and ENSBTAG00000046220 and 510369, guanine phosphoribosyltransferase activity, this GO :0000166 and nucleotide binding and molecular function this GO :0000287 and magnesium ion binding and molecular function this GO :0001975 and response to amphetamine and biological process this GO :0004422 and hypoxanthine phosphoribosyltransferase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006144 and purine nucleobase metabolic process and biological process this GO :0006164 and purine nucleotide biosynthetic process and biological process this GO :0006166 and purine ribonucleoside salvage and biological process this GO :0006168 and adenine salvage and biological process this GO :0006178 and guanine salvage and biological process this GO :0007625 and grooming behavior and biological process this GO :0007626 and locomotory behavior and biological process this GO :0009116 and nucleoside metabolic process and biological process this GO :0019835 and cytolysis and biological process this GO :0021756 and striatum development and biological process this GO :0021895 and cerebral cortex neuron differentiation and biological process this GO :0021954 and central nervous system neuron development and biological process this GO :0032263 and GMP salvage and biological process this GO :0032264 and IMP salvage and biological process this GO :0042417 and dopamine metabolic process and biological process this GO :0042802 and identical protein binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0043101 and purine-containing compound salvage and biological process this GO :0043103 and hypoxanthine salvage and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0045964 and positive regulation of dopamine metabolic process and biological process this GO :0046038 and GMP catabolic process and biological process this GO :0046040 and IMP metabolic process and biological process this GO :0046083 and adenine metabolic process and biological process this GO :0046100 and hypoxanthine metabolic process and biological process this GO :0046651 and lymphocyte proliferation and biological process this GO :0048813 and dendrite morphogenesis and biological process this GO :0051289 and protein homotetramerization and biological process this GO :0052657 and guanine phosphoribosyltransferase activity and molecular function this GO :0055086 and nucleobase-containing small molecule metabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0000166 : nucleotide binding, this GO :0000166 : nucleotide binding and also this GO :0000287 : magnesium ion binding and also this GO :0004422 : hypoxanthine phosphoribosyltransferase activity and also this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding and also this GO :0042803 : protein homodimerization activity and also this GO :0052657 : guanine phosphoribosyltransferase activity, this GO :0000287 : magnesium ion binding, this GO :0004422 : hypoxanthine phosphoribosyltransferase activity, this GO :0005515 : protein binding, this GO :0042802 : identical protein binding, this GO :0042803 : protein homodimerization activity, this GO :0052657 : guanine phosphoribosyltransferase activity, hypoxanthine phosphoribosyltransferase 1
Identity: 5157
Gene: HPRT1 | More about : HPRT1
Long gene name: hypoxanthine phosphoribosyltransferase 1
Synonyms gene: HPRT
Synonyms: HGPRT
Synonyms name: Lesch-Nyhan syndrome
Locus: Xq26, 2-q26, 3
Discovery year: 2001-06-22
GenBank acession: M26434
Entrez gene record: 3251
Pubmed identfication: 12175903
RefSeq identity: NM_000194
Havana BLAST/BLAT: OTTHUMG00000022452
Locus Specific Databases: Hypoxanthine Guanine Phosphoribosyltransferase 1, Lech-Nyhan Syndrome

Related Products :

C294 Recombinant Human HGPRT, HPRT1 (N-6His) 1 mg 2283 € novo human
GENTAUR-58b827f292060 Schistosoma mansoni Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) 100ug 1829 € MBS Recombinant Proteins human
GENTAUR-58b827f319746 Schistosoma mansoni Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) 1000ug 1829 € MBS Recombinant Proteins human
GENTAUR-58b827f372edc Schistosoma mansoni Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) 100ug 2343 € MBS Recombinant Proteins human
GENTAUR-58b827f3d7708 Schistosoma mansoni Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) 1000ug 2343 € MBS Recombinant Proteins human
GENTAUR-58b852fed5691 Schistosoma mansoni Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) 100ug 1829 € MBS Recombinant Proteins human
GENTAUR-58b852ff3f06d Schistosoma mansoni Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) 1000ug 1829 € MBS Recombinant Proteins human
GENTAUR-58b852ffa8b0b Schistosoma mansoni Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) 100ug 2343 € MBS Recombinant Proteins human
GENTAUR-58b85300144c1 Schistosoma mansoni Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) 1000ug 2343 € MBS Recombinant Proteins human
GWB-P1453J HPRT1, 1-218aa, Recombinant Protein bulk Ask price € genways bulk human
abx151840 Anti-Human HPRT1 ELISA Kit inquire 50 € abbex human
GWB-BSP209 HPRT1 Human Protein bulk Ask price € genways bulk human
LV183748 HPRT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV183749 HPRT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV183750 HPRT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV183751 HPRT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV183753 HPRT1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV183752 HPRT1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
DL-HPRT1-Hu Human Hypoxanthine Phosphoribosyltransferase 1 HPRT1 ELISA Kit 96T 846 € DL elisas human
GENTAUR-58bdee58402d5 Anti- HPRT1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdee5910bbd Anti- HPRT1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be11d69aa9b Anti- HPRT1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be11d7017d6 Anti- HPRT1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be4476e772b Anti- HPRT1 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be583e5f220 Anti- HPRT1 Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58be583f02c09 Anti- HPRT1 Antibody 100ug 387 € MBS Polyclonals human
GENTAUR-58be583f79156 Anti- HPRT1 Antibody 0.2 mg 558 € MBS Polyclonals human
abx145239 Anti-HPRT1 Antibody 100 μg 369 € abbex human
abx216030 Anti-HPRT1 Antibody inquire 50 € abbex human
AR09522PU-L anti-HPRT1 / HPRT (1-218, His-tag) Antibody 0,5 mg 1022 € acr human