| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human HGPRT is produced by our E, coli expression system and the target gene encoding Met1-Ala218 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
27, 79 kD |
| UniProt number: |
P00492 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
2 mM EDTA, 250 mM sodium chloride, 30% Glycerol, pH 8, 2 um filtered solution of 20 mM Tris, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKAVEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
HPRT1 (N-6His), HGPRT |
| Short name: |
HPRT1 (N-6His), Recombinant HGPRT |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
hypoxanthine phosphoribosyltransferase 1 (N-6His), sapiens HGPRT, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Cytoplasm, HGPRT and HPRT, HPRT1 and IDBG-86864 and ENSG00000165704 and 3251, Hprt and IDBG-145409 and ENSMUSG00000025630 and 15452, LOC510369 and IDBG-640500 and ENSBTAG00000046220 and 510369, guanine phosphoribosyltransferase activity, this GO :0000166 and nucleotide binding and molecular function this GO :0000287 and magnesium ion binding and molecular function this GO :0001975 and response to amphetamine and biological process this GO :0004422 and hypoxanthine phosphoribosyltransferase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006144 and purine nucleobase metabolic process and biological process this GO :0006164 and purine nucleotide biosynthetic process and biological process this GO :0006166 and purine ribonucleoside salvage and biological process this GO :0006168 and adenine salvage and biological process this GO :0006178 and guanine salvage and biological process this GO :0007625 and grooming behavior and biological process this GO :0007626 and locomotory behavior and biological process this GO :0009116 and nucleoside metabolic process and biological process this GO :0019835 and cytolysis and biological process this GO :0021756 and striatum development and biological process this GO :0021895 and cerebral cortex neuron differentiation and biological process this GO :0021954 and central nervous system neuron development and biological process this GO :0032263 and GMP salvage and biological process this GO :0032264 and IMP salvage and biological process this GO :0042417 and dopamine metabolic process and biological process this GO :0042802 and identical protein binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0043101 and purine-containing compound salvage and biological process this GO :0043103 and hypoxanthine salvage and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0045964 and positive regulation of dopamine metabolic process and biological process this GO :0046038 and GMP catabolic process and biological process this GO :0046040 and IMP metabolic process and biological process this GO :0046083 and adenine metabolic process and biological process this GO :0046100 and hypoxanthine metabolic process and biological process this GO :0046651 and lymphocyte proliferation and biological process this GO :0048813 and dendrite morphogenesis and biological process this GO :0051289 and protein homotetramerization and biological process this GO :0052657 and guanine phosphoribosyltransferase activity and molecular function this GO :0055086 and nucleobase-containing small molecule metabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0000166 : nucleotide binding, this GO :0000166 : nucleotide binding and also this GO :0000287 : magnesium ion binding and also this GO :0004422 : hypoxanthine phosphoribosyltransferase activity and also this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding and also this GO :0042803 : protein homodimerization activity and also this GO :0052657 : guanine phosphoribosyltransferase activity, this GO :0000287 : magnesium ion binding, this GO :0004422 : hypoxanthine phosphoribosyltransferase activity, this GO :0005515 : protein binding, this GO :0042802 : identical protein binding, this GO :0042803 : protein homodimerization activity, this GO :0052657 : guanine phosphoribosyltransferase activity, hypoxanthine phosphoribosyltransferase 1 |
| Identity: |
5157 |
| Gene: |
HPRT1 |
More about : HPRT1 |
| Long gene name: |
hypoxanthine phosphoribosyltransferase 1 |
| Synonyms gene: |
HPRT |
| Synonyms: |
HGPRT |
| Synonyms name: |
Lesch-Nyhan syndrome |
| Locus: |
Xq26, 2-q26, 3 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
M26434 |
| Entrez gene record: |
3251 |
| Pubmed identfication: |
12175903 |
| RefSeq identity: |
NM_000194 |
| Havana BLAST/BLAT: |
OTTHUMG00000022452 |
| Locus Specific Databases: |
Hypoxanthine Guanine Phosphoribosyltransferase 1, Lech-Nyhan Syndrome |