Recombinant Human Zinc Finger MYND Domain-Containing Protein 19, ZMYND19 (N-6His)

Contact us
Catalog number: C280
Price: 2486 €
Supplier: novo
Product name: Recombinant Human Zinc Finger MYND Domain-Containing Protein 19, ZMYND19 (N-6His)
Quantity: 1 mg
Other quantities: 1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Zinc Finger MYND Domain-Containing Protein 19 is produced by our E, coli expression system and the target gene encoding Met1-Arg227 is expressed with a 6His tag at the N-terminus
Molecular Weight: 28, 6 kD
UniProt number: Q96E35
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKKHCRERKRPFQHELEPER
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ZMYND19 (N-6His), Zinc Finger MYND Domain Protein 19
Short name: ZMYND19 (N-6His), Recombinant Zinc Finger MYND Domain- Protein 19
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ZMYND19 (N-6His), sapiens Zinc Finger MYND Domain-Containing Protein 19, recombinant H
Alternative technique: rec
Identity: 21146
Gene: ZMYND19 | More about : ZMYND19
Long gene name: zinc finger MYND-type containing 19
Synonyms: MIZIP
Locus: 9q34, 3
Discovery year: 2003-05-20
GenBank acession: BC012948
Entrez gene record: 116225
RefSeq identity: NM_138462
Classification: Zinc fingers MYND-type
Havana BLAST/BLAT: OTTHUMG00000020992

Related Products :

C280 Recombinant Human Zinc Finger MYND Domain-Containing Protein 19, ZMYND19 (N-6His) 500 µg 1613 € novo human
AE10449MO-48 ELISA test for Mouse Zinc finger MYND domain-containing protein 19 (ZMYND19) 1x plate of 48 wells 373 € abebio mouse
AE10449MO-96 Mouse Zinc finger MYND domain-containing protein 19 (ZMYND19) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
MBS619807 Zinc finger protein 350 (ZBRK1, ZNF350, KRAB zinc finger protein ZFQR, ZFQR, Zinc finger and BRCA1-interacting protein with a KRAB domain 1, Zinc-finger protein ZBRK1) Antibody 100ug 536 € MBS Polyclonals_1 human
MBS612590 Rabenosyn 5 (FYVE-finger-containing Rab5 Effector Protein Rabenosyn-5, Zinc Finger FYVE Domain Containing 20, Zinc Finger FYVE Domain-containing Protein 20, ZFYVE20) 100ug 735 € MBS Polyclonals_1 human
MBS624594 ZBTB16, phosphorylated (Tyr334) (Zinc Finger And BTB Domain-containing Protein 16, Zinc Finger Protein PLZF, Promyelocytic Leukemia Zinc Finger Protein, Zinc Finger Protein 145, ZBTB16, PLZF, ZNF145) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS619945 ZNF265 (Zinc Finger Protein 265, ZRANB2, DKFZp686J1831, DKFZp686N09117, FLJ41119, Zinc Finger RAN Binding Domain Containing 2, Zinc Finger Ran-binding Domain-containing Protein 2, ZIS1, ZIS2) Antibody 100ug 785 € MBS Polyclonals_1 human
MBS615590 Roquin (KIAA2025, Ring Finger and CCCH-type Zinc Finger Domain 1, RING Finger and C3H Zinc Finger Protein 1, RC3H1, RING Finger Protein 198, RNF198, RP5-1198E17.5, Sanroque Protein) Antibody 100ul 785 € MBS Polyclonals_1 human
MBS621899 ZNF230 (Zinc Finger Protein 230, C3HC4 Like Zinc Finger Protein, C3HC4-like Zinc Finger Protein, MGC8715, Ring Finger Protein 141, RNF141, ZFP26) 100ug 735 € MBS Polyclonals_1 human
MBS619801 Zinc Finger and Homeobox 1 (Zinc Finger and Homeodomain Protein 1, Zinc Fingers and Homeobox 1, Zinc Fingers and Homeoboxes 1, Zinc Fingers and Homeoboxes Protein 1, ZHX 1, ZHX1, ZHX-1) Antibody 100ul 785 € MBS Polyclonals_1 human
GENTAUR-58ba6d50c0d47 Human Zinc finger MYND domain-containing protein 10 (ZMYND10) 100ug 2232 € MBS Recombinant Proteins human
GENTAUR-58ba6d5158961 Human Zinc finger MYND domain-containing protein 10 (ZMYND10) 1000ug 2232 € MBS Recombinant Proteins human
GENTAUR-58ba6d51d9512 Human Zinc finger MYND domain-containing protein 10 (ZMYND10) 100ug 2746 € MBS Recombinant Proteins human
GENTAUR-58ba6d527119d Human Zinc finger MYND domain-containing protein 10 (ZMYND10) 1000ug 2746 € MBS Recombinant Proteins human
AE56972MO-48 ELISA test for Mouse Zinc finger MYND domain-containing protein 10 (ZMYND10) 1x plate of 48 wells 373 € abebio mouse
AE10454MO-48 ELISA test for Mouse Zinc finger MYND domain-containing protein 11 (ZMYND11) 1x plate of 48 wells 373 € abebio mouse
AE10451MO-48 ELISA test for Mouse Zinc finger MYND domain-containing protein 17 (ZMYND17) 1x plate of 48 wells 373 € abebio mouse
AE56972MO-96 Mouse Zinc finger MYND domain-containing protein 10 (ZMYND10) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
AE10454MO-96 Mouse Zinc finger MYND domain-containing protein 11 (ZMYND11) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
GENTAUR-58bd968c2e651 Mouse Zinc finger MYND domain-containing protein 17 (Zmynd17) 100ug 2243 € MBS Recombinant Proteins mouse
GENTAUR-58bd968c638bc Mouse Zinc finger MYND domain-containing protein 17 (Zmynd17) 1000ug 2243 € MBS Recombinant Proteins mouse
GENTAUR-58bd968cb44fd Mouse Zinc finger MYND domain-containing protein 17 (Zmynd17) 100ug 2757 € MBS Recombinant Proteins mouse
GENTAUR-58bd968d0fde4 Mouse Zinc finger MYND domain-containing protein 17 (Zmynd17) 1000ug 2757 € MBS Recombinant Proteins mouse
AE10451MO-96 Mouse Zinc finger MYND domain-containing protein 17 (ZMYND17) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
MBS619645 ZCWCC1 (Zinc Finger CW Type Coiled-coil Domain Protein 1, Zinc Finger CW-type with Coiled-coil Domain 1, CW-type with Coiled-coil Domain 1, KIAA0852, MORC2, Zing Finger CW-type 3, ZCW3) 100ul 785 € MBS Polyclonals_1 human
MBS620448 ZNF261 (Zinc Finger Protein 261, ZFP261, DXS6673E, HGNC:13054, KIAA0385, MYM, XFIM, Zinc Finger MYM Type 3, Zinc Finger MYM-type Protein 3, ZMYM3, ZMYM3 Protein, ZNF198L2) Antibody 100ul 785 € MBS Polyclonals_1 human
MBS619211 PR Set7 (SET8, SET Domain Containing 8, SET Domain-containing Protein 8, SET Domain Containing Lysine Methyltransferase 8, SET Domain-containing (Lysine Methyltransferase) 8, SETD8, H4 K20 Specific Histone Methyltransferase, H4-K20-HMTase SETD8, PR/SET Do Antibody 100ul 730 € MBS Polyclonals_1 human
CH34 Recombinant Human Zinc Finger and BTB Domain-Containing Protein 9, ZBTB9 (C-6His) 10 µg 202 € novo human
CE55 Recombinant Human Zinc Finger BED Domain-Containing Protein 1, ZBED1 (C-6His) 50 µg 496 € novo human
CG05 Recombinant Human Zinc Finger C4H2 Domain-Containing Protein, ZC4H2, HCA127 (N-6His) 1 mg 2486 € novo human