| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Apoptosis-Inducing Factor 1 is produced by our E, coli expression system and the target gene encoding Glu121-Asp613 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
2 kD, 56 |
| UniProt number: |
O95831 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
AIFM1 (N-6His), Factor 1 Mitochondrial |
| Short name: |
AIFM1 (N-6His), Recombinant Apoptosis-Inducing Factor 1 Mitochondrial |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
1 (N-6His), apoptosis-inducing factor, mitochondrion-associated, sapiens programmed cellular destruction-Inducing Factor 1 Mitochondrial, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
1, AIF and CMT2D and CMTX4 and COWCK and COXPD6 and NADMR and NAMSD and PDCD8, AIFM1 and IDBG-630636 and ENSBTAG00000006838 and 535714, AIFM1 and IDBG-85972 and ENSG00000156709 and 9131, Aifm1 and IDBG-143630 and ENSMUSG00000036932 and 26926, acting on NAD(P)H, acting on NAD(P)H and also this GO :0046983 : protein dimerization activity and also this GO :0050660 : flavin adenine dinucleotide binding and also this GO :0071949 : FAD binding, acting on NAD(P)H and molecular function this GO :0030182 and neuron differentiation and biological process this GO :0030261 and chromosome condensation and biological process this GO :0032981 and mitochondrial respiratory chain complex I assembly and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0045454 and cell redox homeostasis and biological process this GO :0046983 and protein dimerization activity and molecular function this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050660 and flavin adenine dinucleotide binding and molecular function this GO :0051402 and neuron apoptotic process and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0070059 and intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress and biological process this GO :0071949 and FAD binding and molecular function this GO :1902510 and regulation of apoptotic DNA fragmentation and biological process, mitochondrion-associated, nuclei, oxidoreductase activity, this GO :0003677 and DNA binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005743 and mitochondrial inner membrane and cellular component this GO :0005758 and mitochondrial intermembrane space and cellular component this GO :0005829 and cytosol and cellular component this GO :0006308 and DNA catabolic process and biological process this GO :0006915 and apoptotic process and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0009055 and electron carrier activity and molecular function this GO :0010942 and positive regulation of cell death and biological process this GO :0016174 and NAD(P)H oxidase activity and molecular function this GO :0016491 and oxidoreductase activity and molecular function this GO :0016651 and oxidoreductase activity, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0005515 : protein binding and also this GO :0009055 : electron carrier activity and also this GO :0016174 : NAD(P)H oxidase activity and also this GO :0016491 : oxidoreductase activity and also this GO :0016651 : oxidoreductase activity, this GO :0005515 : protein binding, this GO :0009055 : electron carrier activity, this GO :0016174 : NAD(P)H oxidase activity, this GO :0016491 : oxidoreductase activity, this GO :0016651 : oxidoreductase activity, this GO :0046983 : protein dimerization activity, this GO :0050660 : flavin adenine dinucleotide binding, this GO :0071949 : FAD binding, apoptosis-inducing factor |
| Identity: |
8768 |
| Gene: |
AIFM1 |
More about : AIFM1 |
| Long gene name: |
apoptosis inducing factor mitochondria associated 1 |
| Synonyms gene: |
PDCD8 NAMSD |
| Synonyms gene name: |
1 apoptosis inducing factor, axonal, mitochondria associated 1 , mitochondrion-associated, motor-sensory with deafness and mental retardation (Cowchock syndrome) apoptosis-inducing factor, programmed cell death 8 (apoptosis-inducing factor) neuropathy |
| Synonyms: |
AIF CMTX4 |
| Locus: |
Xq26, 1 |
| Discovery year: |
1999-05-28 |
| GenBank acession: |
AF100928 |
| Entrez gene record: |
9131 |
| Pubmed identfication: |
9989411 23217327 |
| Havana BLAST/BLAT: |
OTTHUMG00000022392 |
| Locus Specific Databases: |
Mental Retardation database |