Recombinant Human Apoptosis-Inducing Factor 1 Mitochondrial, AIFM1 (N-6His)

Contact us
Catalog number: C272
Price: 2056 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Apoptosis-Inducing Factor 1 Mitochondrial, AIFM1 (N-6His)
Quantity: 1000ug
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Apoptosis-Inducing Factor 1 is produced by our E, coli expression system and the target gene encoding Glu121-Asp613 is expressed with a 6His tag at the N-terminus
Molecular Weight: 2 kD, 56
UniProt number: O95831
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: AIFM1 (N-6His), Factor 1 Mitochondrial
Short name: AIFM1 (N-6His), Recombinant Apoptosis-Inducing Factor 1 Mitochondrial
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: 1 (N-6His), apoptosis-inducing factor, mitochondrion-associated, sapiens programmed cellular destruction-Inducing Factor 1 Mitochondrial, recombinant H
Alternative technique: rec
Alternative to gene target: 1, AIF and CMT2D and CMTX4 and COWCK and COXPD6 and NADMR and NAMSD and PDCD8, AIFM1 and IDBG-630636 and ENSBTAG00000006838 and 535714, AIFM1 and IDBG-85972 and ENSG00000156709 and 9131, Aifm1 and IDBG-143630 and ENSMUSG00000036932 and 26926, acting on NAD(P)H, acting on NAD(P)H and also this GO :0046983 : protein dimerization activity and also this GO :0050660 : flavin adenine dinucleotide binding and also this GO :0071949 : FAD binding, acting on NAD(P)H and molecular function this GO :0030182 and neuron differentiation and biological process this GO :0030261 and chromosome condensation and biological process this GO :0032981 and mitochondrial respiratory chain complex I assembly and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0045454 and cell redox homeostasis and biological process this GO :0046983 and protein dimerization activity and molecular function this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050660 and flavin adenine dinucleotide binding and molecular function this GO :0051402 and neuron apoptotic process and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0070059 and intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress and biological process this GO :0071949 and FAD binding and molecular function this GO :1902510 and regulation of apoptotic DNA fragmentation and biological process, mitochondrion-associated, nuclei, oxidoreductase activity, this GO :0003677 and DNA binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005743 and mitochondrial inner membrane and cellular component this GO :0005758 and mitochondrial intermembrane space and cellular component this GO :0005829 and cytosol and cellular component this GO :0006308 and DNA catabolic process and biological process this GO :0006915 and apoptotic process and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0009055 and electron carrier activity and molecular function this GO :0010942 and positive regulation of cell death and biological process this GO :0016174 and NAD(P)H oxidase activity and molecular function this GO :0016491 and oxidoreductase activity and molecular function this GO :0016651 and oxidoreductase activity, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0005515 : protein binding and also this GO :0009055 : electron carrier activity and also this GO :0016174 : NAD(P)H oxidase activity and also this GO :0016491 : oxidoreductase activity and also this GO :0016651 : oxidoreductase activity, this GO :0005515 : protein binding, this GO :0009055 : electron carrier activity, this GO :0016174 : NAD(P)H oxidase activity, this GO :0016491 : oxidoreductase activity, this GO :0016651 : oxidoreductase activity, this GO :0046983 : protein dimerization activity, this GO :0050660 : flavin adenine dinucleotide binding, this GO :0071949 : FAD binding, apoptosis-inducing factor
Identity: 8768
Gene: AIFM1 | More about : AIFM1
Long gene name: apoptosis inducing factor mitochondria associated 1
Synonyms gene: PDCD8 NAMSD
Synonyms gene name: 1 apoptosis inducing factor, axonal, mitochondria associated 1 , mitochondrion-associated, motor-sensory with deafness and mental retardation (Cowchock syndrome) apoptosis-inducing factor, programmed cell death 8 (apoptosis-inducing factor) neuropathy
Synonyms: AIF CMTX4
Locus: Xq26, 1
Discovery year: 1999-05-28
GenBank acession: AF100928
Entrez gene record: 9131
Pubmed identfication: 9989411 23217327
Havana BLAST/BLAT: OTTHUMG00000022392
Locus Specific Databases: Mental Retardation database

Related Products :

C272 Recombinant Human Apoptosis-Inducing Factor 1 Mitochondrial, AIFM1 (N-6His) 500 µg 1613 € novo human
GENTAUR-58bd8e1dd7eeb Rat Apoptosis-inducing factor 1, mitochondrial (Aifm1) 100ug 2415 € MBS Recombinant Proteins rat
GENTAUR-58bd8e1e493f3 Rat Apoptosis-inducing factor 1, mitochondrial (Aifm1) 1000ug 2415 € MBS Recombinant Proteins rat
GENTAUR-58bd8e1ebf9f8 Rat Apoptosis-inducing factor 1, mitochondrial (Aifm1) 100ug 2923 € MBS Recombinant Proteins rat
GENTAUR-58bd8e1f4701b Rat Apoptosis-inducing factor 1, mitochondrial (Aifm1) 1000ug 2923 € MBS Recombinant Proteins rat
GWB-5FF138 Apoptosis-inducing Factor (AIFM1 PDCD8) Rabbit antibody to or anti-Human Polyclonal (aa517-531) antibody 1 tube 648 € genways human
GWB-A99E49 Apoptosis-inducing Factor (AIFM1 PDCD8) Rabbit antibody to or anti-Human Polyclonal (aa593-606) antibody 1 vial 602 € genways human
MBS616948 Prostate Apoptosis Response Protein 4 (Par4 Induced by Effectors of Apoptosis, PAWR, PRKC Apoptosis WT1 Regulator Protein, Prostate Apoptosis Response 4 Protein, Prostate Apoptosis Response Protein PAR-4, Transcriptional Repressor PAR4, WT1 Interacting Pr 100ul 575 € MBS Polyclonals_1 human
MBS616038 PLEKHG5 (Pleckstrin Homology Domain Containing Family G (with RhoGef domain) Member 5, APO3, Apo-3, Apoptosis-inducing Receptor AIR, Apoptosis-mediating Receptor DR3, Apoptosis-mediating Receptor TRAMP, Death Domain Receptor 3, DDR3, DR3, DSMA4, Guanine N Antibody 200ul 735 € MBS Polyclonals_1 human
MBS619110 XIAP (X Linked Inhibitor of Apoptosis, X-linked Inhibitor of Apoptosis Protein, X-linked IAP, Apoptosis Inhibitor 3, API3, Baculoviral IAP Repeat Containing 4, Baculoviral IAP Repeat-containing Protein 4, BIRC4, HILP, IAP 3, IAP3, IAP-like Protein, ILP-1, 50ug 641 € MBS Polyclonals_1 human
abx256407 Anti-Rat Apoptosis-inducing factor 1, mitochondrial ELISA Kit inquire 50 € abbex rat
MA10005MO Apoptosis-inducing factor 1, mitochondrial antibody 100ug 618 € AbELISA Antibodies human
PA20008RA Apoptosis-inducing factor 1, mitochondrial antibody 100ug 618 € AbELISA Antibodies human
R31356 Apoptosis-Inducing Factor Antibody (Mitochondrial marker) 0.1mg 389 € NJS poly human
abx261284 Anti-Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 Protein (Recombinant) 1 mg 3559 € abbex human
abx263420 Anti-Nuclear Apoptosis Inducing Factor 1 Protein (Recombinant) 100 µg 1674 € abbex human
GWB-C2584C Recombinant Human TNF-Related Apoptosis Inducing Ligand/Apo2L (114-281) bulk Ask price € genways bulk human
abx260412 Anti-TNF-Related Apoptosis Inducing Ligand/Apo2L (114-281) Protein (Recombinant) 1 mg 2428 € abbex human
abx263503 Anti-TNF-Related Apoptosis Inducing Ligand/Apo2L Protein (Recombinant) 1 mg 1862 € abbex human
abx263507 Anti-TNF-Related Apoptosis Inducing Ligand/Apo2L Protein (Recombinant) 1 mg 1862 € abbex human
abx261149 Anti-Tumor Protein P53 Regulated Apoptosis Inducing Protein 1 Protein (Recombinant) 20 µg 340 € abbex human
MBS280106 Anti-Human Apoptosis-inducing factor 1, mitochondrial(AIFM1) PAb 100ug 536 € MBS Polyclonals_1 human
abx570120 Anti-Human Apoptosis Inducing Factor (AIF) ELISA Kit inquire 50 € abbex human
abx190029 Anti-Human Apoptosis Inducing Factor CLIA Kit inquire 50 € abbex human
abx251984 Anti-Human Apoptosis Inducing Factor ELISA Kit inquire 50 € abbex human
abx250480 Anti-Human Nuclear apoptosis-inducing factor 1 ELISA Kit inquire 50 € abbex human
abx190082 Anti-Human Tumor Necrosis Factor Related Apoptosis Inducing Ligand CLIA Kit 96 tests 1079 € abbex human
abx253490 Anti-Human Tumor Necrosis Factor Related Apoptosis Inducing Ligand ELISA Kit inquire 50 € abbex human
GENTAUR-58bd61568c679 Human Apoptosis-inducing factor 2 (AIFM2) 100ug 2056 € MBS Recombinant Proteins human
GENTAUR-58bd6156deaa7 Human Apoptosis-inducing factor 2 (AIFM2) 1000ug 2056 € MBS Recombinant Proteins human