Recombinant Human DCN1-Like Protein 1, DCUN1D1 (N-6His)

Contact us
Catalog number: C271
Price: 485 €
Supplier: acr
Product name: Recombinant Human DCN1-Like Protein 1, DCUN1D1 (N-6His)
Quantity: 0,1 mg
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human DCN1-Like Protein 1 is produced by our E, coli expression system and the target gene encoding Met1-Val259 is expressed with a 6His tag at the N-terminus
Molecular Weight: 3 kD, 32
UniProt number: Q96GG9
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: DCUN1D1 (N-6His), DCN1-Like Protein 1
Short name: DCUN1D1 (N-6His), Recombinant DCN1-Like Protein 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: DCUN1D1 (N-6His), sapiens DCN1-Like Protein 1, recombinant H
Alternative technique: rec
Identity: 18184
Gene: DCUN1D1 | More about : DCUN1D1
Long gene name: defective in cullin neddylation 1 domain containing 1
Synonyms gene name: DCN1, cerevisiae) , defective in cullin neddylation 1, domain containing 1 (S
Synonyms: RP42 SCRO DCUN1L1 Tes3 SCCRO
Synonyms name: squamous cell carcinoma related oncogene
Locus: 3q26, 33
Discovery year: 2005-07-11
GenBank acession: AF292100 AK056335
Entrez gene record: 54165
Pubmed identfication: 10777668 15988528
RefSeq identity: NM_020640
Havana BLAST/BLAT: OTTHUMG00000158314

Related Products :

C271 Recombinant Human DCN1-Like Protein 1, DCUN1D1 (N-6His) 50 µg 496 € novo human
GENTAUR-58bda89f3cd32 Rat DCN1-like protein 3 (Dcun1d3) 100ug 1879 € MBS Recombinant Proteins rat
GENTAUR-58bda89fb7e00 Rat DCN1-like protein 3 (Dcun1d3) 1000ug 1879 € MBS Recombinant Proteins rat
GENTAUR-58bda8a03a4e8 Rat DCN1-like protein 3 (Dcun1d3) 100ug 2393 € MBS Recombinant Proteins rat
GENTAUR-58bda8a094b67 Rat DCN1-like protein 3 (Dcun1d3) 1000ug 2393 € MBS Recombinant Proteins rat
abx260843 Anti-DCUN1D1 Protein (Recombinant) 5 µg 238 € abbex human
GWB-P1154J DCUN1D1, 1-259aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-BSP452 DCUN1D1 Human Protein bulk Ask price € genways bulk human
GENTAUR-58bdab693d987 Candida albicans Defective in cullin neddylation protein 1 (DCN1) 100ug 1879 € MBS Recombinant Proteins human
GENTAUR-58bdab698ff64 Candida albicans Defective in cullin neddylation protein 1 (DCN1) 1000ug 1879 € MBS Recombinant Proteins human
GENTAUR-58bdab69e1ea7 Candida albicans Defective in cullin neddylation protein 1 (DCN1) 100ug 2393 € MBS Recombinant Proteins human
GENTAUR-58bdab6a4bd5e Candida albicans Defective in cullin neddylation protein 1 (DCN1) 1000ug 2393 € MBS Recombinant Proteins human
GENTAUR-58b9f8605d6cc Cryptococcus neoformans var. neoformans serotype D Defective in cullin neddylation protein 1 (DCN1) 100ug 1818 € MBS Recombinant Proteins human
GENTAUR-58b9f860dd5bf Cryptococcus neoformans var. neoformans serotype D Defective in cullin neddylation protein 1 (DCN1) 1000ug 1818 € MBS Recombinant Proteins human
GENTAUR-58b9f8614edc4 Cryptococcus neoformans var. neoformans serotype D Defective in cullin neddylation protein 1 (DCN1) 100ug 2332 € MBS Recombinant Proteins human
GENTAUR-58b9f861b3609 Cryptococcus neoformans var. neoformans serotype D Defective in cullin neddylation protein 1 (DCN1) 1000ug 2332 € MBS Recombinant Proteins human
GENTAUR-58ba3a6293974 Cryptococcus neoformans var. neoformans serotype D Defective in cullin neddylation protein 1 (DCN1) 100ug 1818 € MBS Recombinant Proteins human
GENTAUR-58ba3a6312836 Cryptococcus neoformans var. neoformans serotype D Defective in cullin neddylation protein 1 (DCN1) 1000ug 1818 € MBS Recombinant Proteins human
GENTAUR-58ba3a6395799 Cryptococcus neoformans var. neoformans serotype D Defective in cullin neddylation protein 1 (DCN1) 100ug 2332 € MBS Recombinant Proteins human
GENTAUR-58ba3a646da66 Cryptococcus neoformans var. neoformans serotype D Defective in cullin neddylation protein 1 (DCN1) 1000ug 2332 € MBS Recombinant Proteins human
LV134207 DCUN1D1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV134208 DCUN1D1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV134209 DCUN1D1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV134210 DCUN1D1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV134212 DCUN1D1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV134211 DCUN1D1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
MBS248657 Goat Polyclonal to Human DCUN1D1 / SCCRO Antibody 50ug 597 € MBS Polyclonals_1 human
R35717-100UG DCN1 Antibody 0.1mg 406 € NJS poly human
AR09824PU-L anti-DCUN1D1 (1-259, His-tag) Antibody 0,5 mg 1138 € acr human
AR09824PU-N anti-DCUN1D1 (1-259, His-tag) Antibody 0,1 mg 485 € acr human