Recombinant Human UDP-Glucose 4-Epimerase, GALE (N-6His)

Catalog number:	C263 Buy Now
Price:	1973 €
Supplier:	MBS Recombinant Proteins
Product name:	Recombinant Human UDP-Glucose 4-Epimerase, GALE (N-6His)
Quantity:	100ug
Other quantities:	1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:	human gene recombinant epimerase synonyms dehydrogenasereductase source

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human GALE is produced by our E, coli expression system and the target gene encoding Met1-Ala348 is expressed with a 6His tag at the N-terminus
Molecular Weight:	40, 44 kD
UniProt number:	Q14376
State of the product:	Liquid
Shipping conditions:	Dry ice/ice packs
Formulation:	1 mM EDTA, 150 mM sodium chloride, 2 mM DTT, pH 8, 2 um filtered solution of 50 mM TrisHCl, Supplied as a 0
Storage recommendations:	-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution:	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	MGSSHHHHHHSSGLVPRGSHMAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	GALE (N-6His), UDP-Glucose 4-Epimerase
Short name:	GALE (N-6His), Recombinant UDP-Glucose 4-Epimerase
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	GALE (N-6His), sapiens UDP-Glucose 4-Epimerase, recombinant H
Alternative technique:	rec
Identity:	4116
Gene:	GALE | More about : GALE
Long gene name:	UDP-galactose-4-epimerase
Synonyms gene name:	UDP- , galactose-4-epimerase
Synonyms:	SDR1E1
Synonyms name:	member 1 UDP-glucose 4-epimerase , short chain dehydrogenase/reductase family 1E
Locus:	1p36, 11
Discovery year:	2001-06-22
GenBank acession:	BC050685
Entrez gene record:	2582
Pubmed identfication:	8593531 19027726
RefSeq identity:	NM_000403
Classification:	Short chain dehydrogenase/reductase superfamily
Havana BLAST/BLAT:	OTTHUMG00000002958

• #human
• #gene
• #recombinant
• #epimerase
• #synonyms
• #dehydrogenasereductase
• #source