Recombinant Human Protein SCO1 Homolog Mitochondrial SCO1, SCOD1 (N-GST)

Contact us
Catalog number: C259
Price: 333 €
Supplier: adi
Product name: Recombinant Human Protein SCO1 Homolog Mitochondrial SCO1, SCOD1 (N-GST)
Quantity: 100 μL
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Protein SCO1 Homolog Mitochondrial is produced by our E, coli expression system and the target gene encoding Gly132-Ser300 is expressed with a GST tag at the N-terminus
Molecular Weight: 14 kD, 20
UniProt number: O75880
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 1 mM DTT, pH 7, 2, 2 um filtered solution of 50 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GSPEFHMGKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: SCOD1 (N-GST), Protein SCO1 Homolog Mitochondrial SCO1
Short name: SCOD1 (N-GST), Recombinant Protein SCO1 Homolog Mitochondrial SCO1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: SCOD1 (N-GST), sapiens Protein SCO1 Homolog Mitochondrial SCO1, recombinant H
Alternative technique: rec
Identity: 10603
Gene: SCO1 | More about : SCO1
Long gene name: SCO1, cytochrome c oxidase assembly protein
Synonyms gene: SCOD1
Synonyms gene name: SCO (cytochrome oxidase deficient, yeast) homolog 1 SCO cytochrome oxidase deficient homolog 1 (yeast)
Locus: 17p13, 1
Discovery year: 1998-07-03
GenBank acession: AF026852
Entrez gene record: 6341
Pubmed identfication: 9878253
RefSeq identity: NM_004589
Classification: Mitochondrial respiratory chain complex assembly factors
Havana BLAST/BLAT: OTTHUMG00000130364

Related Products :

C259 Recombinant Human Protein SCO1 Homolog Mitochondrial SCO1, SCOD1 (N-GST) 1 mg 2283 € novo human
AR51748PU-N anti-SCO1 / SCOD1 (132-301, His-tag) Antibody 0,5 mg 1109 € acr human
AR51748PU-S anti-SCO1 / SCOD1 (132-301, His-tag) Antibody 0,1 mg 485 € acr human
AP07730PU-N anti-SCO1 / SCOD1 Antibody 50 Вµg 732 € acr human
AP30766CP-N anti-SCO1 / SCOD1 Control Peptide Antibody 50 Вµg 282 € acr human
GENTAUR-58b9be7795664 Saccharomyces cerevisiae Protein SCO1, mitochondrial (SCO1) 1000ug 1105 € MBS Recombinant Proteins human
GENTAUR-58b9be7804f30 Saccharomyces cerevisiae Protein SCO1, mitochondrial (SCO1) 1000ug 1614 € MBS Recombinant Proteins human
PTEN15-R-10 Recombinant purified Human Phosphatase and tensin homolog (PTEN-GST) fusion Protein (full length, GST-tag) 10 μg 478 € adi human
PTEN15-R-50 Recombinant purified Human Phosphatase and tensin homolog (PTEN-GST) fusion Protein (full length, GST-tag) 50 μg 1058 € adi human
GSTA35-R-100 Recombinant purified human GST-alpha 3 (GST A3-3) protein biologically active 100 μg 985 € adi human
GSTA35-R-25 Recombinant purified human GST-alpha 3 (GST A3-3) protein biologically active 25 μg 405 € adi human
GSTA15-R-100 Recombinant purified human GST-alpha (GST-A1) protein biologically active 100 μg 985 € adi human
GSTA15-R-25 Recombinant purified human GST-alpha (GST-A1) protein biologically active 25 μg 405 € adi human
GSTA12-C Recombinant purified human GST-alpha (GST-A1) protein WB +ve control 100 μL 333 € adi human
GSTM25-R-100 Recombinant purified human GST-mu (GST-M1) protein biologically active 100 μg 985 € adi human
GSTM25-R-25 Recombinant purified human GST-mu (GST-M1) protein biologically active 25 μg 405 € adi human
GSTM12-C Recombinant purified human GST-mu (GST-M1) protein WB +ve control 100 μL 333 € adi human
GSTM35-R-25 Recombinant purified human GST-mu (GST-M2) protein 25 μg 405 € adi human
GSTP35-R-100 Recombinant purified human GST-pi (GST-P1) protein biologically active 100 μg 985 € adi human
GSTP35-R-25 Recombinant purified human GST-pi (GST-P1) protein biologically active 25 μg 405 € adi human
GSTP12-C Recombinant purified human GST-pi (GST-P1) protein WB +ve control 100 μL 333 € adi human
GSTT45-R-100 Recombinant purified human GST-T1-1 (GST T1-1) protein biologically active 100 μg 985 € adi human
GSTT45-R-25 Recombinant purified human GST-T1-1 (GST T1-1) protein biologically active 25 μg 405 € adi human
PTEN11-C Recombinant purified Human PTEN-GST fusion Protein (full length, GST-tag) control for WB 100 μL 333 € adi human
GENTAUR-58b8b147d76f9 Bacillus subtilis SCO1 protein homolog (ypmQ) 100ug 1564 € MBS Recombinant Proteins human
GENTAUR-58b8b14847b5a Bacillus subtilis SCO1 protein homolog (ypmQ) 1000ug 1564 € MBS Recombinant Proteins human
GENTAUR-58b8b148a2971 Bacillus subtilis SCO1 protein homolog (ypmQ) 100ug 2067 € MBS Recombinant Proteins human
GENTAUR-58b8b14920727 Bacillus subtilis SCO1 protein homolog (ypmQ) 1000ug 2067 € MBS Recombinant Proteins human
GSTP11-C Purified rat GST-pi (GST-P1) protein WB +ve control 100 μL 333 € adi human
GSTM11-C Purified rat liver GST-mu (GST-M1) protein WB +ve control 100 μL 333 € adi human