| Catalog number: | C254 |
|---|---|
| Price: | 6662 € |
| Supplier: | abbex |
| Product name: | Recombinant Human Prefoldin Subunit 2, PFDN2 (N-6His) |
| Quantity: | 1 mg |
| Other quantities: | 1 mg 2283€ 500 µg 1613€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human Prefoldin Subunit 2 is produced by our E, coli expression system and the target gene encoding Met1-Ser154 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: | 18, 8 kD |
| UniProt number: | Q9UHV9 |
| State of the product: | Freeze-dried |
| Shipping conditions: | Ambient temperature |
| Formulation: | 1 mM DTT, 50 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0 |
| Storage recommendations: | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | MGSSHHHHHHSSGLVPRGSHMAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | PFDN2 (N-6His), Prefoldin Subunit 2 |
| Short name: | PFDN2 (N-6His), Recombinant Prefoldin Subunit 2 |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | PFDN2 (N-6His), sapiens Prefoldin functionnal sequence 2, recombinant H |
| Alternative technique: | rec |
| Identity: | 8867 |
| Gene: | PFDN2 | More about : PFDN2 |
| Long gene name: | prefoldin subunit 2 |
| Synonyms gene name: | prefoldin 2 |
| Locus: | 1q23, 3 |
| Discovery year: | 1998-08-06 |
| GenBank acession: | AF165883 |
| Entrez gene record: | 5202 |
| Pubmed identfication: | 10051400 |
| RefSeq identity: | NM_012394 |
| Classification: | Prefoldin subunits |
| Havana BLAST/BLAT: | OTTHUMG00000031481 |
| C254 | Recombinant Human Prefoldin Subunit 2, PFDN2 (N-6His) | 500 µg | 1613 € | novo | human |
| AE27923HU-48 | ELISA test for Human Prefoldin subunit 2 (PFDN2) | 1x plate of 48 wells | 373 € | abebio | human |
| GENTAUR-58bd876056195 | Human Prefoldin subunit 2 (PFDN2) | 100ug | 1509 € | MBS Recombinant Proteins | human |
| GENTAUR-58bd8760c7132 | Human Prefoldin subunit 2 (PFDN2) | 1000ug | 1509 € | MBS Recombinant Proteins | human |
| GENTAUR-58bd876135184 | Human Prefoldin subunit 2 (PFDN2) | 100ug | 2011 € | MBS Recombinant Proteins | human |
| GENTAUR-58bd87618db7e | Human Prefoldin subunit 2 (PFDN2) | 1000ug | 2011 € | MBS Recombinant Proteins | human |
| AE27923HU-96 | Human Prefoldin subunit 2 (PFDN2) ELISA Kit | 1x plate of 96 wells | 612 € | abebio | human |
| GENTAUR-58bda841c3d79 | Dictyostelium discoideum Probable prefoldin subunit 2 (pfdn2) | 100ug | 1409 € | MBS Recombinant Proteins | human |
| GENTAUR-58bda8422950d | Dictyostelium discoideum Probable prefoldin subunit 2 (pfdn2) | 1000ug | 1409 € | MBS Recombinant Proteins | human |
| GENTAUR-58bda8429a9e0 | Dictyostelium discoideum Probable prefoldin subunit 2 (pfdn2) | 100ug | 1912 € | MBS Recombinant Proteins | human |
| GENTAUR-58bda842f2976 | Dictyostelium discoideum Probable prefoldin subunit 2 (pfdn2) | 1000ug | 1912 € | MBS Recombinant Proteins | human |
| GENTAUR-58b884b197a58 | Mouse Prefoldin subunit 2 (Pfdn2) | 100ug | 1509 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58b884b1ef36a | Mouse Prefoldin subunit 2 (Pfdn2) | 1000ug | 1509 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58b884b26703c | Mouse Prefoldin subunit 2 (Pfdn2) | 100ug | 2011 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58b884b2b8b09 | Mouse Prefoldin subunit 2 (Pfdn2) | 1000ug | 2011 € | MBS Recombinant Proteins | mouse |
| CE13 | Recombinant Human Prefoldin Subunit 4, PFDN4 (N-6His) | 50 µg | 496 € | novo | human |
| RP-1203H | Recombinant Human PFD2 / PFDN2 Protein (His Tag) | 20μg | 572 € | adv | human |
| GWB-P1264C | PFDN2, 1-154aa, Recombinant Protein | bulk | Ask price € | genways bulk | human |
| GWB-BSP573 | PFDN2 Human Protein | bulk | Ask price € | genways bulk | human |
| LV260329 | PFDN2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| AR09713PU-L | anti-PFDN2 (1-154, His-tag) Antibody | 0,25 mg | 1138 € | acr | human |
| AR09713PU-N | anti-PFDN2 (1-154, His-tag) Antibody | 50 Вµg | 485 € | acr | human |
| abx903954 | Anti-PFDN2 siRNA | 15 nmol | 528 € | abbex | human |
| abx928306 | Anti-PFDN2 siRNA | 30 nmol | 717 € | abbex | human |
| abx928307 | Anti-PFDN2 siRNA | 15 nmol | 528 € | abbex | human |
| GWB-MU489C | PFDN2 antibody | 1 vial | 521 € | genways | human |
| GWB-21D2EA | PFDN2 Over-expression Lysate reagent | 1 x 1 vial | 463 € | genways | human |
| abx166742 | Anti-Prefoldin Subunit 1 Protein (Recombinant) | 50 μg | 601 € | abbex | human |
| abx263213 | Anti-Prefoldin Subunit 1 Protein (Recombinant) | 5 µg | 340 € | abbex | human |
| abx262447 | Anti-Prefoldin Subunit 2 Protein (Recombinant) | 1 mg | 6662 € | abbex | human |